Rv1379 - pyrimidine operon regulatory protein pyrR

Expression: Most Significant Conditions for Rv1379

Protein Domains

Gene Information
Locus	Rv1379
Symbol	pyrR
Gene Name	pyrimidine operon regulatory protein pyrR
Location	1552654 - 1553235 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:582 bp Protein:194 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	695
Related Genes	Acel_1302 CE1733 cg1817 DIP1335 jk1026 MAP1114 MAV_3394 Mkms_2409 Mmcs_2362 MSMEG_3042 MT1423 MUL_1779 Mvan_2659 nfa36240 PPA0995 SAV6862
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1379
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1379 Transcript 1
MGAAGDAAIGRESRELMSAADVGRTISRIAHQIIEKTALDDPVGPDAPRVVLLGIPTRGV
TLANRLAGNITEYSGIHVGHGALDITLYRDDLMIKPPRPLASTSIPAGGIDDALVILVDD
VLYSGRSVRSALDALRDVGRPRAVQLAVLVDRGHRELPLRADYVGKNVPTSRSESVHVRL
REHDGRDGVVISR*

Genomic Sequence

>Rv1379
ATGGGTGCTGCGGGTGATGCCGCAATCGGCCGGGAGTCCCGCGAGTTGATGTCCGCGGCC
GACGTCGGCCGCACGATTTCGCGCATCGCGCATCAGATTATCGAGAAGACCGCGTTAGAT
GACCCAGTCGGACCCGACGCGCCGCGGGTGGTGCTGCTGGGAATCCCGACCCGTGGCGTG
ACGCTGGCGAATCGCCTGGCCGGCAATATCACCGAATACAGCGGCATCCACGTCGGCCAT
GGCGCGCTGGACATCACCCTGTACCGCGACGATCTGATGATCAAGCCGCCGCGGCCCTTG
GCGTCGACGTCGATCCCGGCCGGTGGGATCGATGACGCGCTGGTGATCCTGGTCGATGAC
GTGCTCTACTCCGGGCGCTCGGTGCGTTCCGCCCTGGACGCGCTGCGCGACGTGGGCCGG
CCGCGGGCGGTGCAATTGGCGGTGCTGGTCGACAGGGGTCACCGGGAACTGCCGCTGCGC
GCCGACTATGTGGGCAAGAACGTTCCGACCTCGCGCAGCGAGAGCGTGCACGTGCGGCTG
CGCGAGCACGACGGCCGTGACGGCGTGGTGATCTCGCGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1381	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
Interaction	Regulatory Rv1380	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
Interaction	Regulatory Rv1381	active	shahanup86	2012-10-05
	Structural Analysis authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
Interaction	Regulatory Rv1380	active	shahanup86	2012-10-05
	Structural Analysis authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
Interaction	Regulatory Rv1381	active	shahanup86	2012-10-05
	Structural Analysis KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulatory Rv1380	active	shahanup86	2012-10-05
	Structural Analysis KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulatory Rv1381	active	shahanup86	2012-10-05
	Spectrophotometric authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
Interaction	Regulatory Rv1380	active	shahanup86	2012-10-05
	Spectrophotometric authors,CJ. Fields,RL. Switzer Regulation of pyr gene expression in Mycobacterium smegmatis by PyrR-dependent translational repression. J. Bacteriol. 2007
Interaction	Regulatory Rv1381	active	shahanup86	2012-10-05
	Spectrophotometric KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulatory Rv1380	active	shahanup86	2012-10-05
	Spectrophotometric KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	RegulatedBy Rv1379	active	yamir.moreno	2012-10-05
	Protein structure based inferences. the regulation is infered after the observation of protein structure. KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulates Rv1379	active	yamir.moreno	2012-10-05
	Protein structure based inferences. the regulation is infered after the observation of protein structure. KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulates Rv1385	active	yamir.moreno	2012-10-05
	Protein structure based inferences. the regulation is infered after the observation of protein structure. KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulates Rv1384	active	yamir.moreno	2012-10-05
	Protein structure based inferences. the regulation is infered after the observation of protein structure. KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulates Rv1383	active	yamir.moreno	2012-10-05
	Protein structure based inferences. the regulation is infered after the observation of protein structure. KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulates Rv1381	active	yamir.moreno	2012-10-05
	Protein structure based inferences. the regulation is infered after the observation of protein structure. KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	Regulates Rv1380	active	yamir.moreno	2012-10-05
	Protein structure based inferences. the regulation is infered after the observation of protein structure. KA. Kantardjieff, C. Vasquez et al. Structure of pyrR (Rv1379) from Mycobacterium tuberculosis: a persistence gene and protein drug target. Acta Crystallogr. D Biol. Crystallogr. 2005
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008