Rv1386 - PE family protein

Expression: Most Significant Conditions for Rv1386

Protein Domains

Gene Information
Locus	Rv1386
Symbol	PE15
Gene Name	PE family protein
Location	1561464 - 1561772 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:309 bp Protein:103 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	12655
Related Genes	MAP0122 MAV_0117 ML0538 MT1430 MUL_4336
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1386
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1386 Transcript 1
MTLRVVPESLAGASAAIEAVTARLAAAHAAAAPFIAAVIPPGSDSVSVCNAVEFSVHGSQ
HVAMAAQGVEELGRSGVGVAESGASYAARDALAAASYLSGGL*

Genomic Sequence

>Rv1386
GTGACGTTGCGAGTCGTTCCCGAAAGCCTGGCAGGCGCCAGCGCTGCCATCGAAGCAGTG
ACCGCTCGCCTGGCCGCCGCGCACGCCGCGGCGGCCCCGTTTATCGCGGCGGTCATCCCG
CCTGGGTCCGACTCGGTTTCGGTGTGCAACGCCGTTGAGTTCAGCGTTCACGGTAGTCAG
CATGTGGCAATGGCCGCTCAGGGGGTTGAGGAGCTCGGCCGCTCGGGGGTCGGGGTGGCC
GAATCGGGTGCCAGTTATGCCGCTAGGGATGCGCTGGCGGCGGCGTCGTATCTCAGCGGT
GGGCTATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Regulatory Rv1387	active	styleankit01	2012-10-05
	authors,MJ. Brennan,G. Delogu The PE multigene family: a 'molecular mantra' for mycobacteria. Trends Microbiol. 2002
Interaction	Regulatory Rv1387	active	styleankit01	2012-10-05
	authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	Regulatory Rv1387	active	styleankit01	2012-10-05
	authors,MJ. Brennan,G. Delogu The PE multigene family: a 'molecular mantra' for mycobacteria. Trends Microbiol. 2002
Interaction	Regulatory Rv1387	active	styleankit01	2012-10-05
	authors,NC. Gey van Pittius,SL. Sampson,H. Lee,Y. Kim,PD. van Helden,RM. Warren Evolution and expansion of the Mycobacterium tuberculosis PE and PPE multigene families and their association with the duplication of the ESAT-6 (esx) gene cluster regions. BMC Evol. Biol. 2006
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008