Rv1397c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1397c

Protein Domains

Gene Information
Locus	Rv1397c
Symbol
Gene Name	conserved hypothetical protein
Location	1574112 - 1574513 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:402 bp Protein:134 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8967
Related Genes	MT1441
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1397c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1397c Transcript 1
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLAS
FRVQPATEVIARRAGDMMRRYRRSHNRIGLGDYLIAATADVQDLQLATLNVWHFPMFEQL
KPPFAVPGHRPRA*

Genomic Sequence

>Rv1397c
ATGATCCTTGTCGACTCCGATGTGCTGATCGCGCATTTGCGGGGTGTCGTTGCTGCTCGC
GATTGGCTTGTCAGCGCCCGCAAGGACGGACCGCTGGCGATCAGCGTGGTGTCCACCGCC
GAACTCATCGGCGGAATGCGGACCGCCGAACGGCGCGAGGTGTGGCGCCTGCTTGCATCG
TTTCGGGTACAGCCAGCAACCGAGGTAATCGCACGCCGCGCCGGCGACATGATGCGCCGA
TATCGTCGCAGCCACAACCGGATTGGACTTGGCGACTATCTGATAGCTGCTACCGCCGAC
GTCCAGGACCTGCAATTGGCAACCCTCAACGTGTGGCATTTCCCCATGTTCGAGCAGCTG
AAACCACCATTTGCGGTGCCGGGGCACCGACCGCGGGCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv1398c	active	styleankit01	2012-10-05
	operon (Functional Linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv1398c	active	styleankit01	2012-10-05
	operon (Functional Linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapC10	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Rv2548 (125 aa), FASTA scores: E(): 2.3e-14, (42.4% identity in 125 aa overlap).
Other	stop:1574513	active	rslayden	2012-03-05
	Rv2548 (125 aa), FASTA scores: E(): 2.3e-14, (42.4% identity in 125 aa overlap).
Other	start:1574112	active	rslayden	2012-03-05
	Rv2548 (125 aa), FASTA scores: E(): 2.3e-14, (42.4% identity in 125 aa overlap).
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis protein MTCY159.08C
Other	stop:1574513	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis protein MTCY159.08C
Other	start:1574112	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium tuberculosis protein MTCY159.08C