Rv1398c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1398c

Protein Domains

Gene Information
Locus	Rv1398c
Symbol
Gene Name	conserved hypothetical protein
Location	1574510 - 1574767 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:258 bp Protein:86 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8968
Related Genes	MT1442
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1398c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1398c Transcript 1
MKRTNIYLDEEQTASLDKLAAQEGVSRAELIRLLLNRALTTAGDDLASDLQAINDSFGTL
RHLDPPVRRSGGREQHLAQVWRATS*

Genomic Sequence

>Rv1398c
ATGAAGCGGACCAACATCTACCTCGACGAGGAGCAGACGGCAAGCCTCGACAAGTTGGCC
GCGCAAGAAGGTGTTTCGCGCGCCGAGCTGATCCGCCTCCTGCTGAACCGAGCCCTCACC
ACCGCTGGGGACGACCTTGCATCGGACCTGCAGGCTATAAACGATTCGTTCGGCACGCTT
CGCCACCTGGATCCGCCGGTGCGTCGCTCCGGTGGTCGTGAACAGCACCTTGCCCAGGTG
TGGCGCGCCACCTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv1397c	active	styleankit01	2012-10-05
	operon (Functional Linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv1397c	active	styleankit01	2012-10-05
	operon (Functional Linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Symbol	VapB10	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY159.09C (85 aa), FASTA scores: E(): 0.0035, (37.1% identity in 62 aa overlap); Rv0581, Rv2871, Rv1241, etc.
Other	stop:1574767	active	rslayden	2012-03-05
	MTCY159.09C (85 aa), FASTA scores: E(): 0.0035, (37.1% identity in 62 aa overlap); Rv0581, Rv2871, Rv1241, etc.
Other	start:1574510	active	rslayden	2012-03-05
	MTCY159.09C (85 aa), FASTA scores: E(): 0.0035, (37.1% identity in 62 aa overlap); Rv0581, Rv2871, Rv1241, etc.
Symbol	Vap BC-10	active	rslayden	2012-03-05
	MTCY159.09C (85 aa), FASTA scores: E(): 0.0035, (37.1% identity in 62 aa overlap); Rv0581, Rv2871, Rv1241, etc.
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium proteins Rv2547
Other	stop:1574767	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium proteins Rv2547
Other	start:1574510	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium proteins Rv2547
Symbol	Vap BC-10	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Mycobacterium proteins Rv2547