Rv1436 - glyceraldehyde 3-phosphate dehydrogenase gap

Expression: Most Significant Conditions for Rv1436

Protein Domains

Gene Information
Locus	Rv1436
Symbol	gap
Gene Name	glyceraldehyde 3-phosphate dehydrogenase gap
Location	1613307 - 1614326 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1020 bp Protein:340 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33488
Related Genes	Acel_1114 CE1706 cg1791 DIP1310 jk1001 MAP1164 MAV_3341 Mkms_2450 ML0570 Mmcs_2404 MSMEG_3084 MT1480 MUL_1828 Mvan_2703 nfa35890 PPA0816 SAV6296
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1436
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1436 Transcript 1
MTVRVGINGFGRIGRNFYRALLAQQEQGTADVEVVAANDITDNSTLAHLLKFDSILGRLP
CDVGLEGDDTIVVGRAKIKALAVREGPAALPWGDLGVDVVVESTGLFTNAAKAKGHLDAG
AKKVIISAPATDEDITIVLGVNDDKYDGSQNIISNASCTTNCLAPLAKVLDDEFGIVKGL
MTTIHAYTQDQNLQDGPHKDLRRARAAALNIVPTSTGAAKAIGLVMPQLKGKLDGYALRV
PIPTGSVTDLTVDLSTRASVDEINAAFKAAAEGRLKGILKYYDAPIVSSDIVTDPHSSIF
DSGLTKVIDDQAKVVSWYDNEWGYSNRLVDLVTLVGKSL*

Genomic Sequence

>Rv1436
GTGACGGTCCGAGTAGGCATCAACGGGTTTGGTCGAATCGGACGCAACTTCTACCGGGCC
TTACTGGCCCAACAGGAGCAGGGCACCGCCGACGTGGAGGTGGTCGCCGCCAACGACATC
ACCGACAACAGCACGCTGGCGCATCTGCTCAAATTCGACTCGATTCTGGGCCGGCTGCCT
TGCGATGTCGGCCTCGAAGGCGACGACACCATCGTCGTCGGCCGCGCGAAAATCAAGGCG
CTCGCGGTCCGGGAGGGGCCGGCGGCATTGCCATGGGGAGACCTCGGCGTCGACGTCGTC
GTCGAATCCACCGGCCTGTTCACCAATGCGGCCAAAGCCAAAGGCCACCTGGACGCCGGC
GCCAAGAAGGTGATCATCTCTGCGCCCGCCACCGACGAGGACATCACCATCGTCCTGGGA
GTTAACGACGACAAGTATGACGGCAGCCAGAACATCATCTCCAATGCGTCGTGCACCACG
AACTGCCTTGCGCCGCTGGCCAAAGTGCTCGACGATGAGTTCGGCATCGTCAAGGGCCTG
ATGACCACCATCCACGCCTACACTCAGGATCAGAACCTGCAGGACGGGCCGCACAAGGAC
CTGCGTCGCGCCCGCGCCGCCGCGCTGAACATCGTGCCGACCTCCACCGGCGCGGCCAAG
GCCATCGGCCTGGTGATGCCGCAGCTAAAGGGCAAGCTCGACGGTTATGCGCTGCGGGTG
CCGATCCCCACCGGCTCGGTCACCGACCTTACGGTCGACTTATCCACACGGGCCAGTGTC
GATGAGATCAACGCGGCGTTCAAAGCCGCGGCCGAAGGCAGGCTCAAGGGCATTCTGAAG
TACTACGACGCGCCGATCGTCTCGAGCGACATCGTCACCGACCCGCACAGTTCGATTTTC
GACTCTGGGTTGACCAAAGTCATCGACGACCAGGCCAAGGTGGTGTCGTGGTACGACAAC
GAGTGGGGCTACTCCAACCGCCTGGTTGATCTGGTCACGCTGGTCGGCAAGTCGCTCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv0014c	active	yashabhasin	2012-10-05
	Structural Analysis authors,BK. Ratha,MS. Kanungo Induction of particulate and soluble isoenzymes of tyrosine aminotransferase by hydrocortisone in the liver of rats as a function of age. Biochem. Biophys. Res. Commun. 1977
Interaction	Signaling Rv0014c	active	yashabhasin	2012-10-05
	Structural Analysis authors,H. Nürnberger [Quantitative colorimetric determination of 1-(4-cyclohexylureidophenoxy)-2-hydroxy-3-tert butylaminopropane (talinolol Cordanum, 02-115) in body fluids]. Pharmazie 1975
Interaction	Signaling Rv0014c	active	yashabhasin	2012-10-05
	Structural Analysis authors,KV. Kaloustian,JJ. Poluhowich The role of organic phosphates in modulating the oxygenation behavior of eel hemoglobin. Comp Biochem Physiol A Comp Physiol 1976
Interaction	Signaling Rv0014c	active	yashabhasin	2012-10-05
	Spectrophotometric authors,BK. Ratha,MS. Kanungo Induction of particulate and soluble isoenzymes of tyrosine aminotransferase by hydrocortisone in the liver of rats as a function of age. Biochem. Biophys. Res. Commun. 1977
Interaction	Signaling Rv0014c	active	yashabhasin	2012-10-05
	Spectrophotometric authors,H. Nürnberger [Quantitative colorimetric determination of 1-(4-cyclohexylureidophenoxy)-2-hydroxy-3-tert butylaminopropane (talinolol Cordanum, 02-115) in body fluids]. Pharmazie 1975
Interaction	Signaling Rv0014c	active	yashabhasin	2012-10-05
	Spectrophotometric authors,KV. Kaloustian,JJ. Poluhowich The role of organic phosphates in modulating the oxygenation behavior of eel hemoglobin. Comp Biochem Physiol A Comp Physiol 1976
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1785c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv1785c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Term	EC:1.2.1.12 Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype AE. Parker,LE. Bermudez Sequence and characterization of the glyceraldehyde-3-phosphate dehydrogenase of Mycobacterium avium: correlation with an epidermal growth factor binding protein. Microb. Pathog. 2000
Term	EC:1.2.1.59 Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)(+)) (phosphorylating). - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype AE. Parker,LE. Bermudez Sequence and characterization of the glyceraldehyde-3-phosphate dehydrogenase of Mycobacterium avium: correlation with an epidermal growth factor binding protein. Microb. Pathog. 2000
Term	EC:1.2.1.12 Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:1.2.1.59 Glyceraldehyde-3-phosphate dehydrogenase (NAD(P)(+)) (phosphorylating). - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011