Rv1456c - antibiotic-transport membrane ABC transporter

Expression: Most Significant Conditions for Rv1456c

Protein Domains

Gene Information
Locus	Rv1456c
Symbol
Gene Name	antibiotic-transport membrane ABC transporter
Location	1641493 - 1642425 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:933 bp Protein:311 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	678
Related Genes	Acel_1133 CE1691 cg1769 DIP1300 jk0989 MAP1182c MAV_3324 Mkms_2474 ML0587 Mmcs_2429 MSMEG_3117 MT1503 MUL_1857 Mvan_2726 nfa35670 PPA1559 SAV6320
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1456c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1456c Transcript 1
MPYDRAVSPSLRVQRVIAAIVILTQGGIAVTGAIVRVTASGLGCPTWPQCFPGSFTPVVV
AEVPRVHQAVEFGNRMVTFAVVIAAALAVLVVTRARRRTEVLAYAWLMPVSTVVQAMIGG
ITVRTGLLWWTVAIHLLASMTMVWLAVLLYVKIGQPDDGVVHELVVSPLRALTALSALNL
AAVLVTGTLVTAAGPHAGDRSPSRTVPRLKVEITTLVHMHSSLLVAYLALLIGLGFGLLA
VGATRAILVRLAVLLALVATQAAVGTTQYFTGVPAALVAIHVAGAAAVTAATAALWASMG
ERAQPQPLQR*

Genomic Sequence

>Rv1456c
GTGCCTTACGATCGGGCGGTGTCTCCCAGCCTGCGTGTCCAGCGGGTCATCGCCGCAATC
GTCATCCTCACCCAGGGCGGCATCGCCGTCACCGGGGCAATCGTCCGGGTTACCGCCTCA
GGCCTGGGGTGTCCGACCTGGCCGCAGTGTTTTCCGGGTAGCTTCACCCCGGTGGTGGTC
GCCGAGGTGCCGCGGGTCCATCAGGCGGTCGAGTTCGGCAACCGGATGGTCACGTTTGCG
GTGGTGATAGCCGCGGCACTGGCCGTGCTGGTCGTCACCCGGGCGCGCCGGCGCACGGAA
GTCCTGGCCTACGCGTGGCTGATGCCGGTGTCGACGGTGGTGCAGGCGATGATCGGTGGC
ATCACCGTACGCACCGGGCTGCTGTGGTGGACGGTGGCCATCCACCTGCTGGCGTCGATG
ACGATGGTGTGGCTGGCGGTGCTGCTCTACGTCAAGATCGGCCAGCCCGATGACGGAGTC
GTCCACGAACTGGTGGTCAGCCCGTTGCGTGCGCTCACGGCGCTCAGCGCGCTGAACCTG
GCCGCGGTGCTGGTGACGGGCACGCTAGTCACGGCGGCAGGCCCGCACGCGGGAGATCGC
AGCCCCAGCCGGACCGTGCCGCGGCTGAAAGTCGAAATCACCACCTTGGTGCATATGCAT
TCGTCGCTGTTGGTTGCCTACCTTGCGCTGCTGATCGGGTTGGGTTTCGGGCTGCTGGCC
GTGGGTGCCACCCGGGCGATTCTGGTGCGACTCGCCGTGCTGCTCGCCCTGGTTGCCACG
CAAGCCGCCGTCGGTACCACGCAATACTTCACCGGGGTACCCGCCGCCCTGGTCGCCATT
CACGTGGCCGGTGCCGCGGCGGTTACGGCGGCCACCGCCGCGCTATGGGCGTCGATGGGA
GAACGGGCCCAGCCCCAGCCGCTCCAACGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	jgalag	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	ashwinigbhat	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,S. Berg,D. Kaur,M. Jackson,PJ. Brennan The glycosyltransferases of Mycobacterium tuberculosis - roles in the synthesis of arabinogalactan, lipoarabinomannan, and other glycoconjugates. Glycobiology 2007
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	priti.priety	2012-10-05
	Operon (Functional linkage) authors,J. Liu,A. Mushegian Three monophyletic superfamilies account for the majority of the known glycosyltransferases. Protein Sci. 2003
Interaction	PhysicalInteraction Rv1459c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,D. Kaur,ME. Guerin,H. Skovierová,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
Interaction	PhysicalInteraction Rv1458c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,D. Kaur,ME. Guerin,H. Skovierová,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
Interaction	PhysicalInteraction Rv1457c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,D. Kaur,ME. Guerin,H. Skovierová,PJ. Brennan,M. Jackson Chapter 2: Biogenesis of the cell wall and other glycoconjugates of Mycobacterium tuberculosis. Adv. Appl. Microbiol. 2009
Interaction	PhysicalInteraction Rv1459c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1458c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1457c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1459c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1458c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1457c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) AK. Mishra, LJ. Alderwick et al. Identification of a novel alpha(1-->6) mannopyranosyltransferase MptB from Corynebacterium glutamicum by deletion of a conserved gene, NCgl1505, affords a lipomannan- and lipoarabinomannan-deficient mutant. Mol. Microbiol. 2008
Interaction	PhysicalInteraction Rv1459c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009
Interaction	PhysicalInteraction Rv1458c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009
Interaction	PhysicalInteraction Rv1457c	active	hibeeluck	2012-10-05
	Operon (Functional linkage) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009