Rv1470 - thioredoxin trxA

Expression: Most Significant Conditions for Rv1470

Protein Domains

Gene Information
Locus	Rv1470
Symbol	trxA
Gene Name	thioredoxin trxA
Location	1658980 - 1659354 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:375 bp Protein:125 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33834
Related Genes	Acel_0542 BL1226 CE2812 cg3299 DIP2284 jk2056 MAP1196 MAV_3308 Mkms_2489 ML1818 Mmcs_2444 MSMEG_3138 MT1516 MT1517 MUL_1478 MUL_1479 Mvan_2740 nfa18780 PPA0487 Rv1471 SAV7347
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1470
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1470 Transcript 1
MTTRDLTAAYFQQTISANSNVLVYFWAPLCAPCDLFTPTYEASSRKHFDVVHGKVNIETE
KDLASIAGVKLLPTLMAFKKGKLVFKQAGIANPAIMDNLVQQLRAYTFKSPAGEGIGPGT
KTSS*

Genomic Sequence

>Rv1470
GTGACCACTCGAGACCTCACGGCGGCGTATTTCCAACAGACCATCTCCGCCAACAGCAAC
GTGCTTGTGTACTTTTGGGCACCGCTGTGCGCCCCGTGCGACCTGTTCACACCGACCTAC
GAGGCGTCGTCGCGGAAACACTTTGACGTCGTGCATGGCAAAGTCAACATCGAAACCGAG
AAAGATCTGGCCTCGATCGCCGGGGTCAAGTTGTTGCCCACGCTGATGGCCTTCAAGAAA
GGCAAGCTGGTCTTCAAACAAGCCGGCATCGCCAATCCCGCGATCATGGACAATCTGGTG
CAACAACTCCGGGCATACACCTTCAAGTCCCCGGCCGGCGAAGGTATCGGCCCTGGAACA
AAGACTTCATCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv1471	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) M. Akif, G. Khare et al. Functional studies of multiple thioredoxins from Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Operon Rv1471	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) authors,J. Lundström,A. Holmgren Protein disulfide-isomerase is a substrate for thioredoxin reductase and has thioredoxin-like activity. J. Biol. Chem. 1990
Interaction	Operon Rv1471	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) SK. Garg, MS. Alam et al. Redox Biology of Mycobacterium tuberculosis H37Rv: protein-protein interaction between GlgB and WhiB1 involves exchange of thiol-disulfide. BMC Biochem. 2009
Interaction	Operon Rv1471	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) M. Akif, G. Khare et al. Functional studies of multiple thioredoxins from Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Operon Rv1471	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) authors,J. Lundström,A. Holmgren Protein disulfide-isomerase is a substrate for thioredoxin reductase and has thioredoxin-like activity. J. Biol. Chem. 1990
Interaction	Operon Rv1471	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) SK. Garg, MS. Alam et al. Redox Biology of Mycobacterium tuberculosis H37Rv: protein-protein interaction between GlgB and WhiB1 involves exchange of thiol-disulfide. BMC Biochem. 2009
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003