Rv1471 - thioredoxin trxB1

Expression: Most Significant Conditions for Rv1471

Protein Domains

Gene Information
Locus	Rv1471
Symbol	trxB1
Gene Name	thioredoxin trxB1
Location	1659370 - 1659741 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:372 bp Protein:124 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33834
Related Genes	Acel_0542 BL1226 CE2812 cg3299 DIP2284 jk2056 MAP1196 MAV_3308 Mkms_2489 ML1818 Mmcs_2444 MSMEG_3138 MT1516 MT1517 MUL_1478 MUL_1479 Mvan_2740 nfa18780 PPA0487 Rv1470 SAV7347
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1471
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1471 Transcript 1
MTTRDLTAAQFNETIQSSDMVLVDYWASWCGPCRAFAPTFAESSEKHPDVVHAKVDTEAE
RELAAAAQIRSIPTIMAFKNGKLLFNQAGALPPAALESLVQQLKAYEVEAGEATTQNGRA
QQA*

Genomic Sequence

>Rv1471
GTGACTACCCGAGACCTCACTGCCGCACAGTTCAACGAAACCATCCAAAGCAGCGACATG
GTGCTCGTCGATTATTGGGCCTCCTGGTGCGGCCCGTGCCGCGCGTTCGCGCCGACCTTT
GCCGAGTCGTCGGAAAAACACCCCGACGTGGTGCACGCCAAGGTCGACACCGAAGCCGAA
CGAGAGCTTGCAGCGGCCGCTCAGATCCGATCCATCCCCACGATCATGGCCTTCAAGAAC
GGCAAGTTGTTGTTCAACCAGGCCGGCGCGCTGCCGCCGGCAGCATTGGAGAGCCTGGTG
CAGCAGCTCAAGGCCTACGAGGTGGAGGCCGGCGAAGCCACCACCCAGAACGGGCGAGCC
CAACAAGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Operon Rv1470	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) M. Akif, G. Khare et al. Functional studies of multiple thioredoxins from Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Operon Rv1470	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) authors,J. Lundström,A. Holmgren Protein disulfide-isomerase is a substrate for thioredoxin reductase and has thioredoxin-like activity. J. Biol. Chem. 1990
Interaction	Operon Rv1470	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) SK. Garg, MS. Alam et al. Redox Biology of Mycobacterium tuberculosis H37Rv: protein-protein interaction between GlgB and WhiB1 involves exchange of thiol-disulfide. BMC Biochem. 2009
Interaction	Operon Rv1470	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) M. Akif, G. Khare et al. Functional studies of multiple thioredoxins from Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	Operon Rv1470	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) authors,J. Lundström,A. Holmgren Protein disulfide-isomerase is a substrate for thioredoxin reductase and has thioredoxin-like activity. J. Biol. Chem. 1990
Interaction	Operon Rv1470	active	vijayachitra	2012-10-05
	Co-expression (Functional linkage) SK. Garg, MS. Alam et al. Redox Biology of Mycobacterium tuberculosis H37Rv: protein-protein interaction between GlgB and WhiB1 involves exchange of thiol-disulfide. BMC Biochem. 2009
Interaction	RegulatedBy Rv3223c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008