Rv1494 - hypothetical protein

Expression: Most Significant Conditions for Rv1494

Protein Domains

Gene Information
Locus	Rv1494
Symbol
Gene Name	hypothetical protein
Location	1686271 - 1686573 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:303 bp Protein:101 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8975
Related Genes	MT1541
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1494
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1494 Transcript 1
MPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDE
QLDAAYAAAIHDNPAYPYESEAERSAARARRNARQQRSAQ*

Genomic Sequence

>Rv1494
GTGCCGTTTCTGGTTGCATTATCCGGTATCATCTCGGGCGTGCGTGATCATTCGATGACC
GTGCGGCTCGACCAGCAAACTCGCCAGCGCCTGCAAGACATTGTGAAAGGCGGATACCGG
AGCGCTAATGCGGCGATCGTCGACGCCATCAACAAGCGCTGGGAGGCGCTACACGATGAG
CAACTCGACGCCGCCTACGCGGCCGCGATCCATGACAATCCGGCGTACCCGTACGAGTCT
GAGGCCGAACGGAGCGCCGCGCGGGCCCGGCGCAACGCCAGGCAGCAGCGCTCGGCACAG
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv1495	active	sumaavasthi	2012-10-05
	Functional linkage authors,G. Mittenhuber Occurrence of mazEF-like antitoxin/toxin systems in bacteria. J. Mol. Microbiol. Biotechnol. 1999
Interaction	Inhibits Rv1495	active	sumaavasthi	2012-10-05
	Functional linkage ZL. Shang, L. Bao et al. [Molecular cloning and expression of hypothetical proteins Rv1494 and Rv1495 of M.tuberculosis H37Rv strain.] Nan Fang Yi Ke Da Xue Xue Bao 2007
Interaction	Inhibits Rv1495	active	sumaavasthi	2012-10-05
	Functional linkage authors,G. Mittenhuber Occurrence of mazEF-like antitoxin/toxin systems in bacteria. J. Mol. Microbiol. Biotechnol. 1999
Interaction	Inhibits Rv1495	active	sumaavasthi	2012-10-05
	Functional linkage ZL. Shang, L. Bao et al. [Molecular cloning and expression of hypothetical proteins Rv1494 and Rv1495 of M.tuberculosis H37Rv strain.] Nan Fang Yi Ke Da Xue Xue Bao 2007
Symbol	MazE4	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	stop:1686573	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	start:1686271	active	rslayden	2012-03-05
	Hypothetical unknown protein
Symbol	mazEF-4	active	rslayden	2012-03-05
	Hypothetical unknown protein