Rv1622c - membrane cytochrome D ubiquinol oxidase subunit II cydB

Expression: Most Significant Conditions for Rv1622c

Protein Domains

Gene Information
Locus	Rv1622c
Symbol	cydB
Gene Name	membrane cytochrome D ubiquinol oxidase subunit II cydB
Location	1823360 - 1824400 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1041 bp Protein:347 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28296
Related Genes	Acel_0599 CE1252 cg1300 DIP1899 MAP1315c MAV_3165 Mkms_3096 Mmcs_3037 MSMEG_3232 MT1658 MUL_1603 Mvan_2829 nfa5860 PPA0175 SAV4259
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1622c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1622c Transcript 1
MVLQELWFGVIAALFLGFFILEGFDFGVGMLMAPFAHVGMGDPETHRRTALNTIGPVWDG
NEVWLITAGAAIFAAFPGWYATVFSALYLPLLAILFGMILRAVAIEWRGKIDDPKWRTGA
DFGIAAGSWLPALLWGVAFAILVRGLPVDANGHVALSIPDVLNAYTLLGGLATAGLFSLY
GAVFIALKTSGPIRDDAYRFAVWLSLPVAGLVAGFGLWTQLAYGKDWTWLVLAVAGCAQA
AATVLVWRRVSDGWAFMCTLIVVAAVVVLLFGALYPNLVPSTLNPQWSLTIHNASSTPYT
LKIMTWVTAFFAPLTVAYQTWTYWVFRQRISAERIPPPTGLARRAP*

Genomic Sequence

>Rv1622c
GTGGTACTCCAAGAATTGTGGTTCGGTGTCATCGCAGCGCTGTTCCTCGGTTTCTTCATC
CTAGAAGGGTTCGACTTCGGCGTGGGCATGCTGATGGCGCCGTTCGCTCATGTCGGTATG
GGCGATCCGGAGACCCACCGGCGCACGGCACTCAACACCATCGGACCGGTCTGGGACGGC
AACGAAGTCTGGCTGATCACCGCCGGCGCGGCCATATTCGCCGCGTTTCCCGGCTGGTAC
GCGACCGTGTTCTCCGCGCTGTATCTGCCGCTGCTGGCGATCCTGTTCGGTATGATCCTG
CGCGCCGTCGCCATCGAATGGCGCGGCAAGATCGACGACCCGAAATGGCGGACCGGGGCA
GACTTCGGGATCGCGGCGGGATCCTGGCTGCCTGCCCTGTTGTGGGGTGTGGCGTTCGCC
ATTCTGGTCCGCGGACTCCCGGTAGACGCGAACGGTCATGTTGCCCTGTCGATTCCCGAC
GTGCTCAACGCCTACACCCTGCTGGGCGGTCTGGCGACCGCCGGACTGTTCTCGCTCTAC
GGCGCGGTGTTCATCGCTTTGAAAACCTCCGGGCCGATCCGCGACGATGCCTACCGATTC
GCCGTATGGCTTTCGCTTCCTGTGGCGGGACTGGTTGCGGGCTTTGGACTTTGGACGCAA
CTGGCATACGGCAAAGACTGGACGTGGCTGGTGCTGGCAGTTGCGGGGTGCGCGCAGGCG
GCGGCGACGGTCTTAGTGTGGCGGCGGGTGTCCGACGGCTGGGCGTTCATGTGCACGTTG
ATAGTCGTGGCGGCTGTGGTGGTGCTGCTGTTCGGCGCGCTGTACCCGAACCTGGTGCCC
TCAACCCTGAACCCGCAGTGGAGCCTAACGATCCATAACGCGTCGTCGACCCCGTACACC
CTCAAGATCATGACGTGGGTGACCGCGTTCTTCGCTCCACTGACGGTGGCGTACCAGACA
TGGACGTATTGGGTTTTCCGGCAACGGATCTCAGCTGAACGGATACCTCCACCCACCGGT
CTGGCGAGGCGCGCGCCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1621c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003