Rv1641 - initiation factor IF-3 infC

Expression: Most Significant Conditions for Rv1641

Protein Domains

Gene Information
Locus	Rv1641
Symbol	infC
Gene Name	initiation factor IF-3 infC
Location	1852273 - 1852878 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:606 bp Protein:202 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	606
Related Genes	Acel_1269 BL1366 CE1509 cg1563 DIP1160 jk0834 MAP1352 MAV_3127 Mkms_3025 ML1394 Mmcs_2981 MSMEG_3793 MT1679 MUL_1627 Mvan_3328 nfa19140 PPA1414 SAV6737 SCO1600
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1641
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1641 Transcript 1
MSTETRVNERIRVPEVRLIGPGGEQVGIVRIEDALRVAADADLDLVEVAPNARPPVCKIM
DYGKYKYEAAQKARESRRNQQQTVVKEQKLRPKIDDHDYETKKGHVVRFLEAGSKVKVTI
MFRGREQSRPELGYRLLQRLGADVADYGFIETSAKQDGRNMTMVLAPHRGAKTRARARHP
GEPAGGPPPKPTAGDSKAAPN*

Genomic Sequence

>Rv1641
ATCAGCACTGAAACCCGCGTCAACGAGCGCATCCGCGTACCTGAAGTCCGATTGATCGGC
CCAGGGGGGGAGCAGGTAGGCATTGTGCGTATCGAAGACGCACTTCGCGTCGCCGCGGAC
GCAGATCTCGACCTTGTCGAAGTTGCTCCCAATGCCAGACCGCCGGTCTGCAAGATCATG
GACTACGGCAAGTACAAGTACGAGGCCGCGCAGAAGGCGCGCGAATCCCGCAGAAACCAA
CAGCAGACCGTCGTCAAAGAACAAAAGCTGCGACCAAAGATTGACGATCACGATTACGAG
ACCAAAAAGGGTCACGTCGTCCGCTTCTTGGAGGCGGGATCGAAGGTCAAGGTCACCATT
ATGTTCCGTGGACGTGAGCAGTCGCGGCCGGAGTTGGGCTATCGATTGCTGCAGCGGCTG
GGTGCGGACGTCGCCGATTACGGATTCATCGAGACGTCCGCCAAGCAGGACGGACGCAAC
ATGACGATGGTGCTGGCACCGCACCGCGGTGCGAAGACCCGCGCTAGGGCCCGCCACCCG
GGTGAACCGGCCGGCGGGCCGCCGCCCAAGCCCACGGCCGGTGACAGCAAAGCCGCACCG
AACTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001