Rv1643 - 50S ribosomal protein L20 rplT

Expression: Most Significant Conditions for Rv1643

Protein Domains

Gene Information
Locus	Rv1643
Symbol	rplT
Gene Name	50S ribosomal protein L20 rplT
Location	1853184 - 1853573 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:390 bp Protein:130 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	608
Related Genes	Acel_1267 BL1367 CE1511 cg1565 DIP1162 jk0836 MAP1354 MAV_3125 Mkms_3023 ML1396 Mmcs_2979 MSMEG_3791 MT1681 MUL_1629 Mvan_3326 nfa19160 PPA1412 SAV6739 SCO1598
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1643
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1643 Transcript 1
MARVKRAVNAHKKRRSILKASRGYRGQRSRLYRKAKEQQLHSLNYAYRDRRARKGEFRKL
WIARINAAARLNDITYNRLIQGLKAAGVEVDRKNLADIAISDPAAFTALVDVARAALPED
VNAPSGEAA*

Genomic Sequence

>Rv1643
ATGGCACGCGTAAAGCGGGCGGTCAACGCCCACAAGAAGCGGCGCAGCATCCTGAAGGCA
TCGCGAGGCTATCGCGGCCAGCGATCGCGGCTTTACCGCAAAGCCAAAGAGCAGCAGCTG
CATTCACTGAACTACGCCTACCGTGACCGCCGGGCGCGTAAGGGCGAGTTCCGCAAGTTG
TGGATCGCACGGATCAACGCGGCTGCGCGCCTCAACGACATCACCTACAACCGGCTTATC
CAGGGGCTGAAGGCCGCCGGCGTCGAGGTGGACCGGAAAAACCTCGCCGACATTGCGATC
AGCGACCCGGCGGCGTTCACCGCGCTGGTCGACGTCGCCCGGGCGGCACTGCCCGAAGAC
GTCAACGCCCCCTCCGGGGAGGCCGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1641	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1642	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009