Rv1656 - ornithine carbamoyltransferase argF

Expression: Most Significant Conditions for Rv1656

Protein Domains

Gene Information
Locus	Rv1656
Symbol	argF
Gene Name	ornithine carbamoyltransferase argF
Location	1869922 - 1870845 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:924 bp Protein:308 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33453
Related Genes	Acel_1259 BL1060 CE1530 cg1584 DIP1171 jk0845 MAP1365 MAV_3114 Mkms_3012 ML1410 Mmcs_2968 MSMEG_3772 MT1694 MUL_1648 Mvan_3310 nfa19400 SAV2319 SAV3641 SCO5976
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1656
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1656 Transcript 1
MIRHFLRDDDLSPAEQAEVLELAAELKKDPVSRRPLQGPRGVAVIFDKNSTRTRFSFELG
IAQLGGHAVVVDSGSTQLGRDETLQDTAKVLSRYVDAIVWRTFGQERLDAMASVATVPVI
NALSDEFHPCQVLADLQTIAERKGALRGLRLSYFGDGANNMAHSLLLGGVTAGIHVTVAA
PEGFLPDPSVRAAAERRAQDTGASVTVTADAHAAAAGADVLVTDTWTSMGQENDGLDRVK
PFRPFQLNSRLLALADSDAIVLHCLPAHRGDEITDAVMDGPASAVWDEAENRLHAQKALL
VWLLERS*

Genomic Sequence

>Rv1656
GTGATCAGGCATTTCCTGCGCGACGACGATCTGTCCCCGGCCGAACAGGCCGAGGTGCTC
GAGCTCGCGGCCGAGCTGAAGAAAGACCCGGTTAGCCGTCGTCCCCTGCAAGGGCCGCGC
GGGGTGGCGGTCATCTTCGACAAGAACTCCACCCGCACCCGGTTCTCCTTCGAGCTGGGC
ATCGCGCAGCTGGGCGGGCATGCCGTCGTCGTCGACAGCGGCAGCACCCAGCTGGGCCGC
GACGAAACCCTGCAGGACACCGCAAAGGTGTTGTCCCGCTACGTCGATGCCATCGTCTGG
CGAACCTTCGGCCAAGAGCGGCTGGACGCCATGGCGTCGGTCGCGACGGTGCCCGTGATC
AACGCGCTCTCCGATGAGTTCCATCCGTGTCAGGTGTTGGCCGACCTGCAGACCATCGCC
GAACGCAAGGGGGCGCTGCGCGGCCTGAGGTTGTCCTACTTCGGCGACGGCGCCAACAAC
ATGGCCCACTCGCTGCTGCTCGGCGGGGTCACCGCGGGTATCCACGTCACCGTCGCGGCT
CCCGAGGGCTTCCTGCCCGACCCGTCGGTGCGGGCCGCGGCCGAGCGCCGCGCCCAGGAT
ACCGGCGCCTCGGTGACTGTGACCGCCGACGCCCACGCGGCCGCCGCCGGCGCCGACGTT
CTGGTCACCGACACCTGGACGTCGATGGGCCAGGAAAACGACGGGTTGGACCGAGTGAAG
CCGTTTCGGCCGTTTCAGCTCAACTCGCGACTTCTGGCGCTGGCCGACTCGGATGCCATC
GTGTTGCATTGCCTGCCGGCCCATCGCGGCGACGAGATCACCGACGCGGTGATGGACGGG
CCGGCCAGCGCGGTGTGGGACGAGGCCGAAAACCGGCTGCACGCGCAGAAGGCGCTGCTG
GTGTGGCTGCTGGAGCGCTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1657	active	vashishtrv	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1657	active	vashishtrv	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1657	active	vashishtrv	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1657	active	vashishtrv	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1657	active	shahanup86	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1657	active	shahanup86	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1657	active	shahanup86	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1657	active	shahanup86	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1657	active	ashwinigbhat	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1657	active	priti.priety	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	RegulatedBy Rv1657	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1657	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006