Rv1657 - arginine repressor argR

Expression: Most Significant Conditions for Rv1657

Protein Domains

Gene Information
Locus	Rv1657
Symbol	argR
Gene Name	arginine repressor argR
Location	1870842 - 1871354 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:513 bp Protein:171 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32628
Related Genes	Acel_1258 BL1059 CE1531 cg1585 DIP1172 jk0846 MAP1366 MAV_3113 Mkms_3011 ML1411 Mmcs_2967 MSMEG_3771 MT1695 MUL_1649 Mvan_3309 nfa19410 PPA1405 SAV6767
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1657
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1657 Transcript 1
MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDL
EELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTP
PGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR*

Genomic Sequence

>Rv1657
ATGAGCCGCGCCAAGGCCGCGCCCGTTGCGGGGCCCGAGGTCGCCGCAAACCGCGCCGGC
CGCCAGGCGCGCATCGTGGCGATCCTGTCGTCGGCGCAGGTGCGCAGCCAAAACGAACTG
GCGGCGCTGCTGGCCGCCGAGGGCATCGAGGTCACCCAAGCCACACTGTCACGCGATCTG
GAAGAGCTCGGCGCGGTGAAACTGCGCGGCGCGGACGGCGGCACCGGCATCTACGTGGTG
CCCGAGGACGGCAGCCCGGTGCGCGGCGTCTCGGGCGGTACCGACCGGATGGCGCGGCTG
CTCGGTGAGCTGCTGGTGTCGACCGACGACAGCGGCAACCTCGCGGTGTTGCGCACCCCG
CCGGGCGCGGCGCACTACCTGGCCAGCGCCATCGACCGCGCGGCCCTGCCCCAGGTCGTC
GGCACCATCGCCGGTGATGACACCATCCTGGTGGTGGCCCGCGAGCCGACGACCGGCGCG
CAACTGGCCGGCATGTTCGAGAACCTTCGGTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1659	active	ashwinigbhat	2012-10-05
	KS. Makarova, AA. Mironov et al. Conservation of the binding site for the arginine repressor in all bacterial lineages. Genome Biol. 2001
Interaction	Regulatory Rv1659	active	priti.priety	2012-10-05
	KS. Makarova, AA. Mironov et al. Conservation of the binding site for the arginine repressor in all bacterial lineages. Genome Biol. 2001
Interaction	Regulatory Rv1658	active	ashwinigbhat	2012-10-05
	Structural Analysis KS. Makarova, AA. Mironov et al. Conservation of the binding site for the arginine repressor in all bacterial lineages. Genome Biol. 2001
Interaction	Regulatory Rv1658	active	priti.priety	2012-10-05
	Structural Analysis KS. Makarova, AA. Mironov et al. Conservation of the binding site for the arginine repressor in all bacterial lineages. Genome Biol. 2001
Interaction	Regulatory Rv1656	active	vashishtrv	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1656	active	vashishtrv	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1656	active	vashishtrv	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1656	active	vashishtrv	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1656	active	shahanup86	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1656	active	shahanup86	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1656	active	shahanup86	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1656	active	shahanup86	2012-10-05
	Spectrophotometric LT. Cherney, MM. Cherney et al. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. J. Mol. Biol. 2009
Interaction	Regulatory Rv1656	active	ashwinigbhat	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulatory Rv1656	active	priti.priety	2012-10-05
	Structural Analysis LT. Cherney, MM. Cherney et al. Structure of the C-terminal domain of the arginine repressor protein from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Regulates Rv1384	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2141c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1659	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1657	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1657	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1656	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1655	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1654	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1652	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1383	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1384	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv2141c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1659	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv1657	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1657	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1656	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1655	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1654	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1652	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1383	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006