Rv1663 - polyketide synthase pks17

Expression: Most Significant Conditions for Rv1663

Protein Domains

Gene Information
Locus	Rv1663
Symbol	pks17
Gene Name	polyketide synthase pks17
Location	1886512 - 1888020 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1509 bp Protein:503 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6215
Related Genes	MT1703 nfa55930
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1663
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1663 Transcript 1
MEAGPQRIAQMLAELVELFKTEALHRLPVKSWDVRHAREAYRFLSQARHVGKVVLTMPDA
WAAGTVLITGGTGMAGSAVARHLVSRYGVRQVVLASRAGEHTESVAALVDELGSAGARVQ
VVSCDVADRDAVAGLVASQPDLTAVFHAAGVLDDAVITGLTPERVDKVLRAKVDGAWNLH
ELTRHLDVSAFVLFSSMAGIVGAPGQANYAAANAFLDGLAAYRRSRGLAALSVAWGLWEQ
ASAMTEHLGERDRVRMSRVGLAPLPTNQAMGFLDAALLADRPVVVAARLDRAALAGAELP
ALFSQLVAGPIRRIIDGADEVSGSGLASRLHGLTPEQRHRELTELVCSNAAIVLGHSGTE
IDAHKAFQDLGFDSLTAVELRNRLKTATGLTLPPTLIFDYPTAAELAEHLDIQLANAPAV
TVDQPNPSTRFNEVTRELQALLDQPNWNPDDKTRLIKRLQAILTDCTAPPASSGPSTTHD
DEDITTATESQLFAILDDELGP*

Genomic Sequence

>Rv1663
ATGGAGGCCGGACCGCAGCGGATTGCGCAGATGCTGGCCGAGTTAGTCGAGTTGTTCAAA
ACTGAAGCGCTGCATCGGCTTCCAGTCAAGTCATGGGATGTGCGGCACGCTCGGGAGGCG
TATCGGTTCTTGAGCCAGGCGCGCCATGTCGGCAAAGTGGTGCTGACCATGCCGGACGCG
TGGGCCGCGGGCACGGTGCTGATCACCGGTGGCACTGGGATGGCAGGTTCTGCGGTGGCG
CGTCATCTGGTGAGTCGATACGGGGTGCGGCAGGTGGTGTTGGCCAGTCGTGCTGGTGAG
CACACGGAGAGCGTCGCAGCATTGGTGGACGAGCTCGGCTCGGCCGGCGCCCGAGTGCAG
GTGGTGTCTTGCGATGTGGCCGATCGTGATGCGGTGGCGGGTTTGGTGGCAAGCCAACCA
GATCTGACTGCAGTGTTTCATGCGGCTGGGGTTCTTGACGATGCGGTAATCACCGGATTG
ACGCCGGAGCGGGTGGATAAGGTATTGCGGGCCAAGGTCGATGGGGCCTGGAATTTGCAT
GAGCTCACCCGGCACCTGGATGTGTCAGCGTTTGTGTTGTTTTCGTCGATGGCCGGGATT
GTGGGTGCGCCGGGCCAGGCCAATTATGCTGCAGCGAACGCGTTTTTGGACGGGTTGGCG
GCCTATCGGCGATCACGTGGACTGGCCGCGTTGTCGGTGGCGTGGGGATTGTGGGAGCAG
GCTTCGGCGATGACCGAGCATTTAGGCGAGCGGGATCGGGTCCGGATGAGTCGGGTTGGA
CTGGCGCCGTTGCCTACCAACCAGGCGATGGGATTCCTGGATGCCGCGTTGCTGGCGGAT
CGGCCCGTGGTGGTGGCTGCTCGGCTGGATCGTGCCGCGCTGGCCGGTGCCGAGCTGCCG
GCACTATTTAGCCAGTTGGTTGCCGGTCCGATCCGACGGATCATCGACGGCGCCGATGAG
GTGTCGGGGTCGGGATTGGCGTCGCGGCTGCACGGGCTGACTCCCGAGCAGCGGCACCGC
GAACTCACCGAGTTAGTATGTAGCAACGCCGCGATCGTGTTGGGGCATTCCGGCACTGAG
ATCGACGCGCACAAGGCATTCCAGGATCTCGGGTTTGATTCGCTGACAGCGGTGGAGCTG
CGCAACCGGCTCAAGACTGCGACCGGGTTGACCTTGCCACCGACCTTGATCTTTGACTAC
CCCACGGCCGCCGAGTTGGCCGAACACCTCGACATCCAGCTGGCGAACGCCCCTGCCGTC
ACGGTCGACCAACCCAACCCGTCGACTCGTTTCAACGAGGTCACCCGCGAACTACAAGCA
TTGCTCGACCAACCCAACTGGAACCCCGACGACAAAACGCGCCTGATCAAGCGATTGCAA
GCGATTTTGACCGATTGCACCGCTCCACCGGCCAGCTCCGGCCCGTCTACCACCCATGAC
GACGAGGACATCACCACCGCCACTGAAAGCCAGCTTTTTGCCATCCTCGACGACGAACTT
GGACCTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:FASm2002 fatty acid synthase - methyl-arachidic acid - ISS	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm2002 fatty acid synthase - methyl-arachidic acid - IDA	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm2001 fatty acid synthase - tri-methyl behenic acid - ISS	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm2001 fatty acid synthase - tri-methyl behenic acid - IDA	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm1801 fatty acid synthase - dimethyl arachic acid - ISS	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm1801 fatty acid synthase - dimethyl arachic acid - IDA	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm180 fatty acid synthase - tuberculostearic acid - ISS	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	EC:2.3.1.85 Fatty-acid synthase. - ISS	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm180 fatty acid synthase - tuberculostearic acid - IDA	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	EC:2.3.1.85 Fatty-acid synthase. - IDA	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm1601 fatty acid synthase - methyl octadecanoic acid - ISS	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Term	TBRXN:FASm1601 fatty acid synthase - methyl octadecanoic acid - IDA	active	njamshidi	2012-10-05
	lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474 VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1664	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1664	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1662	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1661	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1662	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	PhysicalInteraction Rv1661	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	PhysicalInteraction Rv1662	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv1661	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv1662	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1661	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1662	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	PhysicalInteraction Rv1661	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	PhysicalInteraction Rv1662	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv1661	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv1662	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1662	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	PhysicalInteraction Rv1662	active	vashishtrv	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv1662	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
Interaction	PhysicalInteraction Rv1662	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
Interaction	PhysicalInteraction Rv1662	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Name	Mas-like protein; synthesis of mono methyl branched C16 to C20 unsaturated acids [that are minor constituents of acyltrehaloses and sulfated acyltrehaloses]	active	mjackson	2012-10-05
	Polymethyl-branched acyltrehaloses
Symbol	pks8-pks17	active	mjackson	2012-10-05
	Polymethyl-branched acyltrehaloses