Rv1675c - transcriptional regulator

Expression: Most Significant Conditions for Rv1675c

Protein Domains

Gene Information
Locus	Rv1675c
Symbol
Gene Name	transcriptional regulator
Location	1900241 - 1900975 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:735 bp Protein:245 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	25893
Related Genes	MT1714 MUL_3415
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1675c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1675c Transcript 1
MADRSVRPLRHLVHAVTGGQPPSEAQVRQAAWIARCVGRGGSAPLHRDDVSALAETLQVK
EFAPGAVVFHADQTADGVWIVRHGLIELAVGSRRRRAVVNILHPGDVDGDIPLLLEMPMV
YTGRALTQATCLFLDRQAFERLLATHPAIARRWLSSVAQRVSTAQIRLMGMLGRPLPAQV
AQLLLDEAIDARIELAQRTLAAMLGAQRPSINKILKEFERDRLITVGYAVIEITDQHGLR
ARAQ*

Genomic Sequence

>Rv1675c
ATGGCAGATCGGTCGGTGCGCCCGCTGCGGCATCTCGTTCATGCGGTGACTGGGGGCCAA
CCGCCTTCCGAGGCCCAGGTCCGACAGGCAGCCTGGATTGCGCGGTGCGTCGGTCGCGGA
GGCTCGGCGCCACTGCACCGTGACGATGTGTCGGCATTGGCCGAAACGTTACAAGTCAAG
GAGTTTGCCCCCGGGGCAGTGGTATTCCACGCCGATCAAACCGCGGACGGGGTGTGGATT
GTGCGACACGGATTAATTGAGCTCGCGGTCGGCTCCAGGCGGCGCCGCGCCGTGGTGAAC
ATCCTTCATCCCGGCGATGTCGATGGCGACATCCCGCTGCTACTGGAGATGCCGATGGTC
TACACGGGGCGCGCCTTGACCCAAGCGACCTGCCTGTTCCTGGACCGGCAGGCGTTCGAG
CGGCTGCTAGCTACCCACCCGGCCATCGCACGGCGGTGGCTGTCGAGTGTGGCGCAACGG
GTGTCGACTGCGCAGATTCGGTTAATGGGCATGCTTGGCCGCCCGCTGCCCGCGCAGGTT
GCGCAGCTCCTGCTCGACGAGGCAATCGATGCCCGTATCGAACTTGCCCAACGCACCCTC
GCCGCAATGCTTGGAGCGCAGCGCCCATCGATCAACAAGATTCTCAAGGAGTTCGAGCGC
GACCGATTGATCACCGTCGGGTATGCGGTCATCGAGATCACCGACCAACACGGATTACGC
GCCCGGGCTCAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1265	active	jgalag	2012-10-05
	Band shift MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv0532	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv0532	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv0532	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv0440	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv0440	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv0440	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv0440	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1240	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1240	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1240	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1240	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv2971	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv2971	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv2971	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv2971	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1265	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1265	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1265	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008
Interaction	Regulates Rv1265	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Proteomic studies. Regulated gene product concentrations measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) using proteomics techniques. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . MA. Gazdik, G. Bai et al. Rv1675c (cmr) regulates intramacrophage and cAMP-induced gene expression in Mycobacterium tuberculosis-complex mycobacteria. Mol. Microbiol. 2008