Rv1687c - ABC transporter ATP-binding protein

Expression: Most Significant Conditions for Rv1687c

Protein Domains

Gene Information
Locus	Rv1687c
Symbol
Gene Name	ABC transporter ATP-binding protein
Location	1912153 - 1912920 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:768 bp Protein:256 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37716
Related Genes	MAP1393c MAV_3085 Mkms_3001 Mmcs_2957 MSMEG_3762 MT1727 MUL_1666 Mvan_3296 nfa19890
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1687c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1687c Transcript 1
MMISSSDELLRDGADPAVIIDQLRVIRGKRLALQDVSVRVACGTITGLLGPSGSGKTTLI
RCIVGSQIIASGSVSVLGQPAGSAELRHRVGYMPQDPTIYNDLRVIDNIRYFAELCGVDR
QAADEVIEAVDLRDHRTARCANLSGGQRARVSLACALVGRPDLLVLDEPTIGLDPVLRVE
LWDRFTALARRGTTLLVSSHVMDEADRCGDLLLLRQGQLLAHTTPHRLRKETGCTSLEEA
FLSIVRRTTTVPAAG*

Genomic Sequence

>Rv1687c
ATGATGATTTCATCAAGTGATGAATTACTTCGCGACGGTGCCGACCCCGCGGTCATCATC
GACCAGCTGCGCGTCATCCGTGGTAAACGCCTTGCCCTGCAGGATGTTTCGGTCCGGGTC
GCCTGCGGCACGATCACCGGCCTGCTCGGTCCGTCCGGGTCGGGCAAGACAACACTGATT
CGCTGCATCGTTGGCTCCCAAATCATTGCCTCGGGTTCGGTGAGCGTGCTGGGCCAACCG
GCTGGGTCAGCCGAACTACGCCATCGGGTTGGATACATGCCTCAGGACCCGACCATTTAC
AACGACCTGCGGGTGATCGACAACATCCGCTACTTCGCCGAACTCTGCGGCGTCGACAGG
CAAGCCGCCGATGAGGTGATCGAAGCGGTGGACCTGCGCGATCACCGCACCGCCCGTTGT
GCCAACCTGTCCGGCGGCCAGCGGGCCCGGGTCTCGCTGGCGTGTGCGCTGGTCGGCCGG
CCTGATCTGCTAGTGCTCGACGAGCCGACCATCGGCCTGGATCCGGTATTGCGCGTCGAA
TTATGGGATCGGTTCACGGCGCTGGCGCGGCGTGGCACCACGCTGTTGGTGTCCAGCCAC
GTAATGGACGAGGCCGACCGCTGCGGCGATCTGTTGCTTCTGCGCCAGGGGCAGCTGCTG
GCCCACACAACGCCGCACCGTCTACGAAAGGAAACCGGATGCACATCACTGGAGGAAGCG
TTTCTGTCCATCGTCCGACGCACCACCACCGTGCCCGCGGCCGGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1686c	active	salluamity1	2012-10-05
	K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv1686c	active	salluamity1	2012-10-05
	TJ. Sullivan, JJ. Truglio et al. High affinity InhA inhibitors with activity against drug-resistant strains of Mycobacterium tuberculosis. ACS Chem. Biol. 2006
Interaction	Signaling Rv1686c	active	hibeeluck	2012-10-05
	authors,EK. Barsom,GF. Hatfull A putative ABC-transport operon of Mycobacterium smegmatis. Gene 1997
Interaction	Signaling Rv1686c	active	hibeeluck	2012-10-05
	authors,J. Reizer,A. Reizer,MH. Saier A new subfamily of bacterial ABC-type transport systems catalyzing export of drugs and carbohydrates. Protein Sci. 1992
Interaction	Signaling Rv1686c	active	hibeeluck	2012-10-05
	authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv1685c	active	shahanup86	2012-10-05
	TJ. Sullivan, JJ. Truglio et al. High affinity InhA inhibitors with activity against drug-resistant strains of Mycobacterium tuberculosis. ACS Chem. Biol. 2006
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006