Rv1721c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1721c

Protein Domains

Gene Information
Locus	Rv1721c
Symbol
Gene Name	conserved hypothetical protein
Location	1947416 - 1947643 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:228 bp Protein:76 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9005
Related Genes	MT1762 PPA2075
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1721c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1721c Transcript 1
MSAMVQIRNVPDELLHELKARAAAQRMSLSDFLLARLAEIAEEPALDDVLDRLAALPRRD
LGASAAELVDEARSE*

Genomic Sequence

>Rv1721c
ATGTCCGCCATGGTTCAGATCCGCAACGTTCCCGACGAGCTTCTCCACGAGCTGAAGGCC
CGCGCAGCGGCGCAACGGATGAGCCTGAGCGATTTCCTCCTAGCACGGCTTGCCGAGATC
GCGGAAGAACCGGCCCTCGACGACGTTCTCGACCGTCTAGCGGCACTGCCGCGCCGGGAT
CTCGGCGCGAGCGCAGCCGAGCTTGTTGACGAGGCTCGATCTGAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	vashishtrv	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv1720c	active	shahanup86	2012-10-05
	Spectrophotometric Assay authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Symbol	VapB12	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	O07227 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (73 aa). Start changed since original submission. Original co-ordinates were 1947414-1947632. New GI:57116902. On Jan 5, 2005 this sequence version replaced gi:15608859.
Other	stop:1947643	active	rslayden	2012-03-05
	O07227 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (73 aa). Start changed since original submission. Original co-ordinates were 1947414-1947632. New GI:57116902. On Jan 5, 2005 this sequence version replaced gi:15608859.
Other	start:1947416	active	rslayden	2012-03-05
	O07227 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (73 aa). Start changed since original submission. Original co-ordinates were 1947414-1947632. New GI:57116902. On Jan 5, 2005 this sequence version replaced gi:15608859.
Symbol	Vap BC-12	active	rslayden	2012-03-05
	O07227 CONSERvED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (73 aa). Start changed since original submission. Original co-ordinates were 1947414-1947632. New GI:57116902. On Jan 5, 2005 this sequence version replaced gi:15608859.
Other	strand:+	active	rslayden	2012-03-05
	MTCY63.05
Other	stop:1947643	active	rslayden	2012-03-05
	MTCY63.05
Other	start:1947416	active	rslayden	2012-03-05
	MTCY63.05
Symbol	Vap BC-12	active	rslayden	2012-03-05
	MTCY63.05
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv0300
Other	stop:1947643	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv0300
Other	start:1947416	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv0300
Symbol	Vap BC-12	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv0300