Rv1731 - succinate-semialdehyde dehydrogenase [NADP+]-dependent gabD2

Expression: Most Significant Conditions for Rv1731

Protein Domains

Gene Information
Locus	Rv1731
Symbol	gabD2
Gene Name	succinate-semialdehyde dehydrogenase [NADP+]-dependent gabD2
Location	1957677 - 1959233 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1557 bp Protein:519 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29195
Related Genes	Acel_1435 MSMEG_5912 MT1772 MUL_3190 nfa26820 SAV4358
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1731
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1731 Transcript 1
MPAPSAEVFDRLRNLAAIKDVAARPTRTIDEVFTGKPLTTIPVGTAADVEAAFAEARAAQ
TDWAKRPVIERAAVIRRYRDLVIENREFLMDLLQAEAGKARWAAQEEIVDLIANANYYAR
VCVDLLKPRKAQPLLPGIGKTTVCYQPKGVVGVISPWNYPMTLTVSDSVPALVAGNAVVL
KPDSQTPYCALACAELLYRAGLPRALYAIVPGPGSVVGTAITDNCDYLMFTGSSATGSRL
AEHAGRRLIGFSAELGGKNPMIVARGANLDKVAKAATRACFSNAGQLCISIERIYVEKDI
AEEFTRKFGDAVRNMKLGTAYDFSVDMGSLISEAQLKTVSGHVDDATAKGAKVIAGGKAR
PDIGPLFYEPTVLTNVAPEMECAANETFGPVVSIYPVADVDEAVEKANDTDYGLNASVWA
GSTAEGQRIAARLRSGTVNVDEGYAFAWGSLSAPMGGMGLSGVGRRHGPEGLLKYTESQT
IATARVFNLDPPFGIPATVWQKSLLPIVRTVMKLPGRR*

Genomic Sequence

>Rv1731
ATGCCTGCACCCTCGGCCGAGGTTTTCGATCGCTTGCGTAACCTGGCCGCGATCAAGGAC
GTCGCCGCACGTCCGACCAGGACGATCGACGAGGTCTTCACCGGCAAGCCGTTGACTACG
ATTCCGGTCGGCACGGCCGCGGACGTCGAAGCGGCATTCGCCGAAGCTCGCGCGGCGCAG
ACCGACTGGGCGAAGCGTCCCGTCATCGAGCGAGCTGCAGTCATCCGCCGCTATCGCGAC
CTGGTCATCGAGAACCGCGAGTTCCTCATGGACCTCCTGCAAGCCGAGGCGGGCAAGGCC
CGATGGGCGGCGCAAGAGGAAATTGTCGATCTGATCGCGAACGCGAATTATTACGCACGA
GTCTGTGTGGACCTGCTGAAGCCCCGTAAGGCACAGCCGCTGCTGCCCGGGATAGGCAAG
ACCACGGTGTGCTATCAACCGAAGGGCGTGGTGGGGGTGATCTCGCCGTGGAACTACCCC
ATGACGCTTACGGTGTCGGACTCGGTGCCCGCGCTGGTGGCCGGTAACGCGGTGGTGCTC
AAGCCGGACAGCCAGACGCCGTATTGTGCGCTCGCGTGTGCCGAGCTGCTGTATCGGGCG
GGTCTGCCGCGAGCGCTGTATGCGATCGTGCCCGGTCCGGGCTCGGTGGTGGGCACCGCC
ATCACCGACAACTGCGACTACCTGATGTTCACCGGTTCATCGGCGACCGGCAGCCGCCTC
GCCGAGCACGCCGGCCGCCGGCTTATCGGTTTCTCGGCCGAACTTGGCGGCAAGAACCCC
ATGATCGTGGCGCGGGGTGCCAACCTCGACAAGGTCGCCAAGGCGGCCACCCGTGCCTGC
TTCTCGAACGCCGGCCAGCTGTGCATCTCCATTGAGCGGATCTACGTCGAAAAGGACATC
GCCGAGGAGTTCACCCGGAAGTTCGGCGATGCGGTGCGGAACATGAAGCTCGGCACCGCA
TACGACTTCTCGGTCGACATGGGTAGTTTGATCTCCGAAGCACAGCTGAAAACCGTGTCC
GGTCACGTGGATGACGCGACGGCCAAGGGCGCCAAGGTGATTGCGGGCGGCAAGGCTCGA
CCCGACATCGGGCCGCTGTTCTACGAGCCGACCGTGCTGACCAACGTCGCACCCGAAATG
GAATGCGCGGCCAACGAGACGTTCGGGCCGGTGGTCTCGATCTACCCGGTCGCCGACGTG
GACGAAGCCGTCGAAAAGGCCAACGACACCGACTACGGGCTCAACGCCAGCGTCTGGGCC
GGCTCCACCGCGGAGGGCCAGAGGATCGCCGCCCGGCTGCGGTCGGGGACGGTGAACGTC
GACGAGGGGTACGCGTTCGCCTGGGGCAGCCTCAGCGCGCCGATGGGCGGGATGGGCCTC
TCGGGGGTCGGCCGCCGGCACGGTCCGGAGGGCTTGCTCAAGTACACCGAATCACAGACG
ATCGCGACCGCCCGCGTGTTCAATCTCGATCCGCCCTTCGGCATCCCGGCCACAGTCTGG
CAGAAGTCACTGTTACCCATCGTGCGCACCGTGATGAAGCTTCCCGGCCGCAGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS	active	njamshidi	2012-10-05
	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Interaction	RegulatedBy Rv2069	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Other	EC:1.2.1.79	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Other	EC:1.2.1.79	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011