Rv1838c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1838c

Protein Domains

Gene Information
Locus	Rv1838c
Symbol
Gene Name	conserved hypothetical protein
Location	2087257 - 2087652 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:396 bp Protein:132 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9029
Related Genes	MT1886
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1838c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1838c Transcript 1
MILVDSNIPMYLVGASHPHKLDAQRLLESALSGGERLVTDAEVLQEICHRYVAIKRREAI
QPAFDAIIGVVDEVLPIERTDVEHARDALLRYQTLSARDALHIAVMAHHDITRLMSFDRG
FDSYPGIKRLA*

Genomic Sequence

>Rv1838c
GTGATCCTCGTTGACTCCAACATTCCCATGTATCTGGTGGGTGCCTCGCACCCGCATAAG
CTGGACGCGCAACGTCTGCTGGAGTCGGCGCTGTCGGGCGGTGAACGCCTAGTCACCGAC
GCCGAGGTGCTGCAGGAGATATGCCACCGGTATGTGGCAATCAAACGCCGTGAGGCGATT
CAGCCGGCTTTCGATGCAATTATCGGCGTGGTCGACGAAGTGCTGCCGATCGAGCGCACC
GATGTCGAACACGCGAGGGATGCCCTGTTGCGCTATCAAACGTTGTCGGCCAGGGATGCA
CTACACATCGCCGTCATGGCTCACCACGACATTACCCGGCTGATGAGCTTCGACCGTGGG
TTCGACTCCTATCCGGGGATCAAGCGTCTGGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1839c	active	ilamathi.raja	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv1839c	active	ilamathi.raja	2012-10-05
	Co-occurrence (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Regulatory Rv1839c	active	ilamathi.raja	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv1839c	active	ilamathi.raja	2012-10-05
	Co-occurrence (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	VapC13	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	CNSPAX06_181 Pyrococcus abyssi complete genome (136 aa), FASTA scores: opt: 197, E(): 2.2e-07, (33. 1% identity in 133 aa overlap).
Other	stop:2087652	active	rslayden	2012-03-05
	CNSPAX06_181 Pyrococcus abyssi complete genome (136 aa), FASTA scores: opt: 197, E(): 2.2e-07, (33. 1% identity in 133 aa overlap).
Other	start:2087257	active	rslayden	2012-03-05
	CNSPAX06_181 Pyrococcus abyssi complete genome (136 aa), FASTA scores: opt: 197, E(): 2.2e-07, (33. 1% identity in 133 aa overlap).
Other	strand:+	active	rslayden	2012-03-05
	AL008883 (126 aa), FASTA scores: opt: 293, E(): 1.5e-14, (38.2% identity in 123 aa overlap); Rv0749, Rv0277c, Rv2530c, etc. Also similar to AJ248288
Other	stop:2087652	active	rslayden	2012-03-05
	AL008883 (126 aa), FASTA scores: opt: 293, E(): 1.5e-14, (38.2% identity in 123 aa overlap); Rv0749, Rv0277c, Rv2530c, etc. Also similar to AJ248288
Other	start:2087257	active	rslayden	2012-03-05
	AL008883 (126 aa), FASTA scores: opt: 293, E(): 1.5e-14, (38.2% identity in 123 aa overlap); Rv0749, Rv0277c, Rv2530c, etc. Also similar to AJ248288
Other	strand:+	active	rslayden	2012-03-05
	MTV003.09
Other	stop:2087652	active	rslayden	2012-03-05
	MTV003.09
Other	start:2087257	active	rslayden	2012-03-05
	MTV003.09
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein. Part of 14-membered Mycobacterium tuberculosis protein family with Rv2863
Other	stop:2087652	active	rslayden	2012-03-05
	Conserved hypothetical protein. Part of 14-membered Mycobacterium tuberculosis protein family with Rv2863
Other	start:2087257	active	rslayden	2012-03-05
	Conserved hypothetical protein. Part of 14-membered Mycobacterium tuberculosis protein family with Rv2863