Rv1846c - transcriptional regulator

Expression: Most Significant Conditions for Rv1846c

Protein Domains

Gene Information
Locus	Rv1846c
Symbol
Gene Name	transcriptional regulator
Location	2096183 - 2096599 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:417 bp Protein:139 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19926
Related Genes	CE0315 cg0027 MAP1559c MAV_2869 Mkms_2854 ML2063 Mmcs_2810 MSMEG_3630 MT1894 MUL_3033 Mvan_3087 nfa25180
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1846c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1846c Transcript 1
MAKLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMTVLQRLAKKNLVLQ
IRDDRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALA
ELEAGHGNRPPAGAATET*

Genomic Sequence

>Rv1846c
ATGGCCAAGCTGACACGGTTGGGGGATTTGGAACGCGCGGTCATGGACCATTTGTGGTCC
AGGACGGAACCCCAAACCGTTCGCCAAGTCCACGAAGCGTTGTCGGCGCGCCGCGACCTT
GCCTACACGACGGTGATGACCGTGCTGCAACGGTTGGCAAAGAAGAACCTCGTGCTGCAG
ATCCGCGACGATCGAGCCCACCGCTACGCTCCCGTGCACGGCCGCGACGAATTGGTCGCC
GGGCTGATGGTCGATGCATTGGCTCAGGCCGAGGACTCCGGCAGCAGGCAAGCCGCGCTG
GTGCACTTCGTCGAGCGAGTCGGTGCCGACGAGGCGGATGCGCTACGACGTGCGCTCGCC
GAATTGGAAGCCGGTCATGGCAATCGGCCACCGGCTGGCGCGGCAACGGAGACTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3921c	active	vijayachitra	2012-10-05
	ChIP (Physical interaction) authors,A. Kuhn From the Sec complex to the membrane insertase YidC. Biol. Chem. 2009
Interaction	Regulatory Rv3921c	active	vijayachitra	2012-10-05
	ChIP (Physical interaction) authors,S. Kol,N. Nouwen,AJ. Driessen Mechanisms of YidC-mediated insertion and assembly of multimeric membrane protein complexes. J. Biol. Chem. 2008
Interaction	Regulatory Rv3921c	active	vijayachitra	2012-10-05
	ChIP (Physical interaction) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009
Interaction	Transcription Rv1303	active	sourish10	2012-10-05
	ChIP (Physical interaction) C. Sala, A. Haouz et al. Genome-wide regulon and crystal structure of BlaI (Rv1846c) from Mycobacterium tuberculosis. Mol. Microbiol. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008