Rv1952 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1952

Protein Domains

Gene Information
Locus	Rv1952
Symbol
Gene Name	conserved hypothetical protein
Location	2200726 - 2200941 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:216 bp Protein:72 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9041
Related Genes	MT2002
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1952
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1952 Transcript 1
MIRNLPEGTKAALRVRAARHHHSVEAEARAILTAGLLGEEVPMPVLLAADSGHDIDFEPE
RLGLIARTPQL*

Genomic Sequence

>Rv1952
GTGATCCGCAACCTTCCCGAGGGGACCAAGGCGGCACTACGGGTCCGTGCTGCACGTCAT
CACCACTCCGTCGAAGCGGAAGCCCGCGCGATCCTCACCGCGGGATTGTTGGGCGAAGAA
GTCCCCATGCCGGTACTGCTGGCCGCCGACAGTGGCCATGACATCGACTTCGAGCCCGAA
CGTCTCGGCCTGATCGCCCGCACCCCGCAACTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv1953	active	prabhakarsmail	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv1953	active	akankshajain.21	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv1953	active	prabhakarsmail	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Inhibits Rv1953	active	akankshajain.21	2012-10-05
	Coexpression(Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Symbol	VapB	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapB14	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Y4JJ_RHISN PUTATIVE PLASMID STABILITY PROTEIN (85 aa), FASTA scores: opt: 127, E(): 0.00096, (42.5% identity in 73 aa overlap).
Other	stop:2200941	active	rslayden	2012-03-05
	Y4JJ_RHISN PUTATIVE PLASMID STABILITY PROTEIN (85 aa), FASTA scores: opt: 127, E(): 0.00096, (42.5% identity in 73 aa overlap).
Other	start:2200726	active	rslayden	2012-03-05
	Y4JJ_RHISN PUTATIVE PLASMID STABILITY PROTEIN (85 aa), FASTA scores: opt: 127, E(): 0.00096, (42.5% identity in 73 aa overlap).
Symbol	Vap BC-14	active	rslayden	2012-03-05
	Y4JJ_RHISN PUTATIVE PLASMID STABILITY PROTEIN (85 aa), FASTA scores: opt: 127, E(): 0.00096, (42.5% identity in 73 aa overlap).
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P55510
Other	stop:2200941	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P55510
Other	start:2200726	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P55510
Symbol	Vap BC-14	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P55510