Rv1959c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1959c

Protein Domains

Gene Information
Locus	Rv1959c
Symbol
Gene Name	conserved hypothetical protein
Location	2203681 - 2203977 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:297 bp Protein:99 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9045
Related Genes	MT2008
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1959c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1959c Transcript 1
MSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRP
GYRKLSAGSHTLFYRVTGEGTIDVVRVLHQRMDVDRNL*

Genomic Sequence

>Rv1959c
GTGAGTAGCCGATACCTTCTCTCGCCTGCCGCGCAGGCACATCTGGAAGAGATCTGGGAC
TGCACCTATGACCGTTGGGGTGTCGATCAGGCCGAGCAGTACCTGCGCGAACTTCAACAC
GCTATCGACCGTGCTGCGGCAAACCCGCGGATCGGACGAGCGTGCGACGAGATTCGCCCC
GGCTATCGCAAGCTCTCGGCCGGGTCACACACGTTGTTCTATCGGGTGACTGGCGAAGGC
ACCATCGACGTCGTGCGAGTCCTGCACCAACGGATGGACGTCGACCGGAACCTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv1960c	active	prabhakarsmail	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1960c	active	akankshajain.21	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1960c	active	prabhakarsmail	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv1960c	active	akankshajain.21	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	ParE1	active	jlew	2012-03-07
	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	YPCD1.08 from Yersinia pestis (99 aa), FASTA scores: opt: 162, E(): 7.3e-05, (33.0% identity in 91 aa overlap); also some similarity to E145339 hypothetical protein (103 aa), FASTA scores: opt: 142, E(): 0.0003, (33.0% identity in 91 aa overlap).
Other	stop:2203977	active	rslayden	2012-03-05
	YPCD1.08 from Yersinia pestis (99 aa), FASTA scores: opt: 162, E(): 7.3e-05, (33.0% identity in 91 aa overlap); also some similarity to E145339 hypothetical protein (103 aa), FASTA scores: opt: 142, E(): 0.0003, (33.0% identity in 91 aa overlap).
Other	start:2203681	active	rslayden	2012-03-05
	YPCD1.08 from Yersinia pestis (99 aa), FASTA scores: opt: 162, E(): 7.3e-05, (33.0% identity in 91 aa overlap); also some similarity to E145339 hypothetical protein (103 aa), FASTA scores: opt: 142, E(): 0.0003, (33.0% identity in 91 aa overlap).
Other	strand:+	active	rslayden	2012-03-05
	Plasmid stabilization system protein. Conserved hypothetical protein, similar to other hypothetical plasmid proteins e.g. AL117189
Other	stop:2203977	active	rslayden	2012-03-05
	Plasmid stabilization system protein. Conserved hypothetical protein, similar to other hypothetical plasmid proteins e.g. AL117189
Other	start:2203681	active	rslayden	2012-03-05
	Plasmid stabilization system protein. Conserved hypothetical protein, similar to other hypothetical plasmid proteins e.g. AL117189