Rv1960c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1960c

Protein Domains

Gene Information
Locus	Rv1960c
Symbol
Gene Name	conserved hypothetical protein
Location	2203974 - 2204225 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:252 bp Protein:84 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9046
Related Genes	MAP4080c MAV_4555 MT2009
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1960c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1960c Transcript 1
MGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERS
GSSTPFDFDGFLGRKRADASRGR*

Genomic Sequence

>Rv1960c
GTGGGTAAGAACACGTCCTTCGTCCTCGACGAGCACTACAGCGCCTTCATCGACGGCGAG
ATCGCCGCGGGCCGCTACCGGTCGGCCAGTGAAGTCATCCGCTCCGCGTTGCGACTGCTC
GAGGACCGTGAAACCCAGCTGCGCGCGCTTCGTGAGGCTCTCGAGGCCGGCGAACGCAGC
GGCAGCTCGACACCGTTCGACTTCGACGGATTCCTCGGTCGTAAGCGGGCTGACGCCTCG
CGTGGCCGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv2142c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,K. Simola,RK. Selander,A. de la Chapelle,G. Corneo,E. Ginelli Molecular basis of chromosome banding. I. The effect of mouse DNA fractions on two fluorescent dyes in vitro. Chromosoma 1975
Interaction	InhibitedBy Rv2142c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	InhibitedBy Rv2142c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,V. Anantharaman,L. Aravind New connections in the prokaryotic toxin-antitoxin network: relationship with the eukaryotic nonsense-mediated RNA decay system. Genome Biol. 2003
Interaction	InhibitedBy Rv2142c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,KM. Dalton,S. Crosson A conserved mode of protein recognition and binding in a ParD-ParE toxin-antitoxin complex. Biochemistry 2010
Interaction	Inhibits Rv1959c	active	prabhakarsmail	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1959c	active	akankshajain.21	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1959c	active	prabhakarsmail	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1959c	active	akankshajain.21	2012-10-05
	Spectrophotometric analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	ParD1	active	jlew	2012-03-07
	Relieves toxin activity. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	AF102990_51 hypothetical protein of Yersinia enterocolitica (80 aa), FASTA scores: opt: 149, E(): 0.00037, (42 .1% identity in 57 aa overlap).
Other	stop:2204225	active	rslayden	2012-03-05
	AF102990_51 hypothetical protein of Yersinia enterocolitica (80 aa), FASTA scores: opt: 149, E(): 0.00037, (42 .1% identity in 57 aa overlap).
Other	start:2203974	active	rslayden	2012-03-05
	AF102990_51 hypothetical protein of Yersinia enterocolitica (80 aa), FASTA scores: opt: 149, E(): 0.00037, (42 .1% identity in 57 aa overlap).
Symbol	Par DE-1	active	rslayden	2012-03-05
	AF102990_51 hypothetical protein of Yersinia enterocolitica (80 aa), FASTA scores: opt: 149, E(): 0.00037, (42 .1% identity in 57 aa overlap).
Other	strand:+	active	rslayden	2012-03-05
	AF102990
Other	stop:2204225	active	rslayden	2012-03-05
	AF102990
Other	start:2203974	active	rslayden	2012-03-05
	AF102990
Symbol	Par DE-1	active	rslayden	2012-03-05
	AF102990
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to O85269
Other	stop:2204225	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to O85269
Other	start:2203974	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to O85269
Symbol	Par DE-1	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to O85269