Rv1967 - MCE-family protein mce3B

Expression: Most Significant Conditions for Rv1967

Protein Domains

Gene Information
Locus	Rv1967
Symbol	mce3B
Gene Name	MCE-family protein mce3B
Location	2210601 - 2211629 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1029 bp Protein:343 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22865
Related Genes	MAV_2533 MT2019 MUL_2869 Mvan_0923
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1967
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1967 Transcript 1
MRENLGGVVVRLGVFLAVCLLTAFLLIAVFGEVRFGDGKTYYAEFANVSNLRTGKLVRIA
GVEVGKVTRISINPDATVRVQFTADNSVTLTRGTRAVIRYDNLFGDRYLALEEGAGGLAV
LRPGHTIPLARTQPALDLDALIGGFKPLFRALNPEQVNALSEQLLHAFAGQGPTIGSLLA
QSAAVTNTLADRDRLIGQVITNLNVVLGSLGAHTDRLDQAVTSLSALIHRLAQRKTDISN
AVAYTNAAAGSVADLLSQARAPLAKVVRETDRVAGIAAADHDYLDNLLNTLPDKYQALVR
QGMYGDFFAFYLCDVVLKVNGKGGQPVYIKLAGQDSGRCAPK*

Genomic Sequence

>Rv1967
ATGAGGGAGAACCTGGGGGGCGTCGTGGTGCGCCTCGGCGTCTTCCTGGCGGTATGCCTG
CTGACGGCGTTCCTGCTGATTGCCGTCTTCGGGGAGGTGCGCTTCGGCGACGGCAAGACC
TACTACGCCGAGTTCGCCAACGTGTCCAATCTGCGAACGGGCAAGCTGGTGCGCATCGCC
GGCGTCGAGGTCGGCAAGGTCACCAGGATCTCCATCAACCCCGACGCGACGGTGCGGGTG
CAGTTCACCGCCGACAACTCGGTCACCCTCACGCGGGGCACCCGGGCGGTGATCCGCTAC
GACAACCTGTTCGGTGACCGCTATTTGGCGCTGGAGGAAGGGGCCGGCGGACTCGCCGTT
CTTCGTCCCGGTCACACGATTCCGTTGGCGCGCACCCAACCGGCGTTGGATCTGGATGCC
CTGATCGGTGGATTCAAGCCGCTGTTTCGTGCGCTGAACCCCGAGCAGGTCAACGCGCTG
AGCGAACAGTTGCTGCACGCGTTTGCCGGACAGGGGCCCACGATCGGGTCATTGCTGGCC
CAGTCCGCGGCCGTGACCAACACCCTGGCCGACCGTGATCGGCTGATCGGGCAGGTGATC
ACCAACCTCAACGTGGTGCTGGGCTCGCTGGGCGCTCACACCGATCGGTTGGACCAGGCG
GTGACGTCGCTATCAGCGTTGATTCACCGGCTCGCGCAACGCAAGACCGACATCTCCAAC
GCCGTGGCCTACACCAACGCCGCCGCCGGCTCGGTCGCCGATCTGCTGTCGCAGGCTCGC
GCGCCGTTGGCGAAGGTGGTTCGCGAGACCGATCGGGTGGCCGGCATCGCGGCCGCCGAC
CACGACTACCTCGACAATCTGCTCAACACGCTGCCGGACAAATACCAGGCGCTGGTCCGC
CAGGGTATGTACGGCGACTTCTTCGCCTTCTACCTGTGCGACGTCGTGCTCAAGGTCAAC
GGCAAGGGCGGCCAGCCGGTGTACATCAAGCTGGCCGGTCAGGACAGCGGGCGGTGCGCG
CCGAAATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	ActivatedBy Rv1975	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression authors,MC. Garcia-Pelayo,KC. Caimi,JK. Inwald,J. Hinds,F. Bigi,MI. Romano,D. van Soolingen,RG. Hewinson,A. Cataldi,SV. Gordon Microarray analysis of Mycobacterium microti reveals deletion of genes encoding PE-PPE proteins and ESAT-6 family antigens. Tuberculosis (Edinb) 2004
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1969	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1969	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1969	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1963c	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1963c	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1969	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1963c	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1969	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1963c	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	RegulatedBy Rv1963c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008