Rv1996 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1996

Protein Domains

Gene Information
Locus	Rv1996
Symbol
Gene Name	conserved hypothetical protein
Location	2239004 - 2239957 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:954 bp Protein:318 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35087
Related Genes	CE2791 cg3255 DIP2276 jk0100 MT2052 MT2061 MT2085 MUL_2234 MUL_2236 MUL_5033 nfa29970 nfa30400 Rv2005c Rv2026c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1996
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1996 Transcript 1
MSAQQTNLGIVVGVDGSPCSHTAVEWAARDAQMRNVALRVVQVVPPVITAPEGWAFEYSR
FQEAQKREIVEHSYLVAQAHQIVEQAHKVALEASSSGRAAQITGEVLHGQIVPTLANISR
QVAMVVLGYRGQGAVAGALLGSVSSSLVRHAHGPVAVIPEEPRPARPPHAPVVVGIDGSP
TSGLAAEIAFDEASRRGVDLVALHAWSDMGPLDFPRLNWAPIEWRNLEDEQEKMLARRLS
GWQDRYPDVVVHKVVVCDRPAPRLLELAQTAQLVVVGSHGRGGFPGMHLGSVSRAVVNSG
QAPVIVARIPQDPAVPA*

Genomic Sequence

>Rv1996
ATGTCAGCCCAACAAACGAACCTCGGAATCGTGGTCGGTGTGGATGGTTCACCCTGCTCG
CATACGGCAGTCGAATGGGCCGCGCGCGATGCGCAGATGCGCAACGTTGCGCTCCGCGTG
GTGCAGGTCGTGCCCCCGGTAATAACCGCCCCGGAAGGGTGGGCATTTGAGTATTCGCGG
TTTCAAGAAGCCCAAAAGCGCGAAATCGTCGAACACTCGTACCTGGTCGCCCAAGCGCAC
CAAATCGTCGAACAGGCCCACAAGGTCGCCCTCGAGGCATCCTCCTCAGGTCGCGCCGCG
CAAATCACCGGCGAAGTGCTGCACGGCCAGATAGTGCCCACGCTGGCCAACATCTCCAGG
CAGGTCGCGATGGTCGTGCTGGGCTACCGAGGTCAGGGCGCCGTAGCCGGCGCCTTGCTG
GGATCGGTCAGCTCAAGCCTGGTTCGCCACGCTCATGGCCCTGTCGCCGTAATACCCGAG
GAGCCGCGACCGGCGCGCCCGCCGCACGCGCCGGTTGTGGTGGGCATCGACGGCTCGCCC
ACCTCGGGATTGGCGGCCGAGATCGCCTTCGACGAGGCATCGCGCCGCGGCGTGGACTTG
GTGGCGCTGCACGCGTGGAGCGACATGGGCCCCCTCGACTTTCCTAGGCTCAATTGGGCG
CCGATCGAATGGAGAAACCTCGAAGACGAGCAGGAGAAAATGCTCGCCCGGCGTCTGAGC
GGATGGCAAGACCGGTATCCCGATGTCGTCGTGCACAAAGTCGTGGTGTGCGATCGACCG
GCACCCCGCCTGCTCGAATTGGCACAAACCGCTCAGCTTGTGGTGGTTGGCAGCCACGGC
CGCGGGGGGTTCCCCGGCATGCATCTCGGCTCAGTCAGCAGAGCGGTGGTCAATTCCGGT
CAGGCTCCGGTTATCGTCGCCCGAATCCCCCAAGATCCGGCAGTGCCGGCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2031c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,SM. Hingley-Wilson,KE. Lougheed,K. Ferguson,S. Leiva,HD. Williams Individual Mycobacterium tuberculosis universal stress protein homologues are dispensable in vitro. Tuberculosis (Edinb) 2010
Interaction	Regulatory Rv3133c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,SM. Hingley-Wilson,KE. Lougheed,K. Ferguson,S. Leiva,HD. Williams Individual Mycobacterium tuberculosis universal stress protein homologues are dispensable in vitro. Tuberculosis (Edinb) 2010
Interaction	Regulatory Rv2031c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv3133c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) MA. Florczyk, LA. McCue et al. A family of acr-coregulated Mycobacterium tuberculosis genes shares a common DNA motif and requires Rv3133c (dosR or devR) for expression. Infect. Immun. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003