Rv2010 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2010

Protein Domains

Gene Information
Locus	Rv2010
Symbol
Gene Name	conserved hypothetical protein
Location	2258273 - 2258671 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:399 bp Protein:133 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9054
Related Genes	MT2065
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2010
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2010 Transcript 1
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLL
QRFAIEPLAPVRDAEDAAAIHRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAI
RTHCGLRTEPLF*

Genomic Sequence

>Rv2010
ATGATCGTCGACACCTCGGTCTGGATCGCATATCTCTCCACGTCAGAGTCGTTGGCCAGT
CGCTGGCTAGCCGATCGCATTGCCGCTGACTCGACGGTGATCGTGCCCGAGGTGGTGATG
ATGGAGCTGCTGATCGGTAAGACCGATGAGGACACCGCCGCACTGCGCCGACGGCTCCTG
CAGCGATTCGCTATCGAACCGCTGGCCCCGGTCCGCGACGCGGAAGATGCCGCCGCCATT
CACCGGCGCTGTCGTCGCGGCGGCGACACCGTACGCAGCCTGATCGATTGCCAGGTGGCC
GCGATGGCGTTGCGGATCGGGGTCGCCGTGGCGCATCGTGATCGCGACTACGAGGCGATC
CGCACACATTGCGGACTACGCACCGAGCCGTTGTTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv2009	active	shahanup86	2012-10-05
	coexpression(Functional Linkage) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	InhibitedBy Rv2009	active	shahanup86	2012-10-05
	coexpression(Functional Linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv2009	active	shahanup86	2012-10-05
	coexpression(Functional Linkage) authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	InhibitedBy Rv2009	active	shahanup86	2012-10-05
	coexpression(Functional Linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Symbol	VapC	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC15	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY48.04c, (38.1%identity in 126 aa overlap)
Other	stop:258671	active	rslayden	2012-03-05
	MTCY48.04c, (38.1%identity in 126 aa overlap)
Other	start:2258273	active	rslayden	2012-03-05
	MTCY48.04c, (38.1%identity in 126 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv1561
Other	stop:258671	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv1561
Other	start:2258273	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to Rv1561