Rv2056c - 30S ribosomal protein S14 rpsN2

Expression: Most Significant Conditions for Rv2056c

Protein Domains

Gene Information
Locus	Rv2056c
Symbol	rpsN2
Gene Name	30S ribosomal protein S14 rpsN2
Location	2314354 - 2314659 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:306 bp Protein:102 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32751
Related Genes	CE0941 cg0989 DIP0849 jk1537 MAP3768c MSMEG_6066 MT2117 MUL_4833 Mvan_5491 nfa49770 PPA2161 SAV4641
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2056c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2056c Transcript 1
MAKKSKIVKNQRRAATVARYASRRTALKDIIRSPSSAPEQRSTAQRALARQPRDASPVRL
RNRDAIDGRPRGHLRKFGLSRVRVRQLAHDGHLPGVRKASW*

Genomic Sequence

>Rv2056c
GTGGCCAAGAAGTCCAAGATCGTCAAGAATCAGCGGCGGGCGGCCACCGTCGCCCGTTAC
GCATCGCGTCGCACCGCGCTCAAAGACATCATCCGATCCCCATCGAGCGCCCCCGAACAG
CGCAGTACCGCCCAGCGAGCCCTTGCCCGCCAGCCCCGCGACGCCAGTCCCGTGCGGTTA
CGCAACCGCGACGCCATCGACGGCCGGCCGCGCGGACATCTCCGCAAATTCGGGCTCTCC
CGTGTGCGGGTCCGCCAACTGGCCCACGACGGACACCTGCCCGGTGTCCGGAAGGCCAGC
TGGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2359	active	devensrcp	2012-10-05
	ChiP (Physical Interaction) authors,GA. Owen,B. Pascoe,D. Kallifidas,MS. Paget Zinc-responsive regulation of alternative ribosomal protein genes in Streptomyces coelicolor involves zur and sigmaR. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv2359	active	devensrcp	2012-10-05
	ChiP (Physical Interaction) A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008