Rv2069 - RNA polymerase sigma factor sigC

Expression: Most Significant Conditions for Rv2069

Protein Domains

Gene Information
Locus	Rv2069
Symbol	sigC
Gene Name	RNA polymerase sigma factor sigC
Location	2326944 - 2327501 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:558 bp Protein:186 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31093
Related Genes	MAP1814 MAV_2426 ML1448 MT2129 MUL_2295
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2069
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2069 Transcript 1
MTATASDDEAVTALALSAAKGNGRALEAFIKATQQDVWRFVAYLSDVGSADDLTQETFLR
AIGAIPRFSARSSARTWLLAIARHVVADHIRHVRSRPRTTRGARPEHLIDGDRHARGFED
LVEVTTMIADLTTDQREALLLTQLLGLSYADAAAVCGCPVGTIRSRVARARDALLADAEP
DDLTG*

Genomic Sequence

>Rv2069
ATGACCGCGACGGCAAGCGACGACGAGGCCGTTACCGCACTCGCCTTGTCGGCGGCCAAG
GGGAACGGGCGGGCCCTTGAGGCGTTTATCAAAGCCACCCAGCAAGACGTGTGGCGGTTC
GTCGCCTATCTGTCCGACGTGGGCAGTGCGGACGATCTCACCCAAGAGACATTCCTACGA
GCGATCGGCGCCATCCCGCGGTTTTCCGCACGCTCCAGCGCCCGAACTTGGTTGCTGGCC
ATCGCGCGCCATGTCGTCGCCGATCACATCCGCCACGTCCGATCCCGGCCCCGCACCACC
CGCGGCGCGCGTCCCGAACATCTCATAGACGGCGACCGCCATGCCCGCGGATTCGAAGAC
CTCGTCGAGGTAACCACGATGATCGCCGACCTAACCACCGACCAACGGGAAGCGCTGCTG
CTGACCCAGCTGCTCGGGCTGTCCTATGCGGACGCCGCGGCGGTGTGCGGCTGCCCGGTG
GGCACCATCCGATCCCGTGTCGCTCGAGCGCGCGATGCGCTGCTTGCCGACGCGGAGCCC
GACGACCTCACCGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv3843c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3482c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Transcription Rv3482c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	Signaling Rv3246c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv3161c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv3064c	active	priydarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv2387	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv0129c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv3246c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv0490	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv2031c	active	ashwinigbhat	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv0129c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv3246c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv0490	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv2031c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv2234	active	ashwinigbhat	2012-10-05
	Structural Analysis J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
Interaction	Regulatory Rv2234	active	ashwinigbhat	2012-10-05
	Spectrophotometric J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
Interaction	Regulatory Rv2234	active	priti.priety	2012-10-05
	Structural Analysis J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
Interaction	Regulatory Rv2234	active	priti.priety	2012-10-05
	Spectrophotometric J. Lei, H. Zhang et al. The Influence of Mycobacterium tuberculosis sigma factors on the promotion efficiency of ptpAt promoter in Mycobacterium smegmatis. Curr. Microbiol. 2005
Interaction	Regulatory Rv1523	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	PhysicalInteraction Rv0723	active	anshula.arora1990	2012-10-05
	ChIP (Physical Interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv0723	active	anshula.arora1990	2012-10-05
	ChIP (Physical Interaction) authors,I. Medow,S. Rüsch-Gerdes,KH. Schröder Comparison of ribosomes and ribosomal proteins of sensitive and resistant mycobacteria. Zentralbl Bakteriol Mikrobiol Hyg A 1987
Interaction	Transcription Rv0681	active	sudhakar_dipu	2012-10-05
	ChIP (Physical interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Transcription Rv0680c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) T. Matsuba, Y. Suzuki et al. Association of the Rv0679c protein with lipids and carbohydrates in Mycobacterium tuberculosis/Mycobacterium bovis BCG. Arch. Microbiol. 2007
Interaction	Transcription Rv0680c	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) T. Matsuba, Y. Suzuki et al. Association of the Rv0679c protein with lipids and carbohydrates in Mycobacterium tuberculosis/Mycobacterium bovis BCG. Arch. Microbiol. 2007
Interaction	Transcription Rv0331	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv0280	active	gaat3s	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Transcription Rv0108c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) R. Sun, PJ. Converse et al. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Mol. Microbiol. 2004
Interaction	Regulatory Rv0096	active	gaurisd10	2012-10-05
	ChIP (Physical Interaction) F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
Interaction	Regulatory Rv0096	active	gaurisd10	2012-10-05
	ChIP (Physical Interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	Regulatory Rv0095c	active	gaurisd10	2012-10-05
	ChIP (Physical Interaction) authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
Interaction	InhibitedBy Rv0093c	active	gaurisd10	2012-10-05
	In silico analysis KG. Thakur,AM. Joshi,B. Gopal Structural and biophysical studies on two promoter recognition domains of the extra-cytoplasmic function sigma factor sigma(C) from Mycobacterium tuberculosis. J. Biol. Chem. 2007
Interaction	Regulates Rv3649	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3584	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3483c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3462c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3314c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3267	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3068c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3064c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv3058c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2909c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2700	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2031c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1731	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1593c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0951	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0643c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0287	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0231	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0144	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0108c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008