Rv2107 - PE family protein

Expression: Most Significant Conditions for Rv2107

Protein Domains

Gene Information
Locus	Rv2107
Symbol	PE22
Gene Name	PE family protein
Location	2367359 - 2367655 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:297 bp Protein:99 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9919
Related Genes	ML0410 MT2166
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2107
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2107 Transcript 1
MSFVNVDPFGMLAAAATLESLGSHMAVSNAAVASVTTKVPPPAADYVSKKLSLFFSSHGQ
QYQVQAARGTAFHRKLVRTLANGALAYEEVEIANNEGF*

Genomic Sequence

>Rv2107
ATGTCCTTTGTGAATGTAGACCCATTTGGGATGTTGGCGGCAGCTGCGACACTGGAGTCC
CTTGGTTCCCACATGGCGGTAAGCAATGCCGCGGTGGCCTCGGTGACCACCAAGGTTCCT
CCCCCGGCCGCCGACTACGTATCAAAAAAGTTATCGCTGTTCTTTAGTAGCCACGGGCAG
CAGTACCAGGTGCAAGCCGCTCGGGGCACGGCCTTTCATCGAAAATTGGTCCGGACCCTG
GCGAATGGCGCGCTTGCGTATGAGGAAGTCGAGATCGCCAACAACGAAGGTTTCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2108	active	kholia.trupti	2012-10-05
	Neighbourhood (Functional linkage) authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2108	active	kholia.trupti	2012-10-05
	Neighbourhood (Functional linkage) S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv2108	active	kholia.trupti	2012-10-05
	Neighbourhood (Functional linkage) authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2108	active	kholia.trupti	2012-10-05
	Neighbourhood (Functional linkage) S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006