Rv2117 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2117

Protein Domains

Gene Information
Locus	Rv2117
Symbol
Gene Name	conserved hypothetical protein
Location	2377148 - 2377441 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:294 bp Protein:98 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	3940
Related Genes	Acel_1514 MAP1841 MAV_2398 Mkms_3197 ML1314 Mmcs_3135 MSMEG_3905 MT2177 MUL_2339 Mvan_3461 nfa40660 SAV2550
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2117
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2117 Transcript 1
MWIGWLEFDVLLGDVRSLKQKRSVTRPLVAELQRKFSVSAAETGSHDLYRRAGIGVAVVS
GDRSHAVDVLDNAERLVAAHPEFELLSVRRGLHRTDD*

Genomic Sequence

>Rv2117
ATGTGGATTGGCTGGCTGGAATTCGACGTGCTGCTGGGCGACGTGCGCTCACTCAAGCAG
AAGCGGTCGGTGACCCGCCCCCTGGTCGCCGAGTTGCAGCGCAAATTCAGCGTGTCGGCC
GCCGAGACCGGTTCGCATGATCTGTACCGGCGGGCGGGCATCGGTGTGGCCGTGGTGTCC
GGTGACCGCAGCCACGCCGTCGATGTCCTCGACAACGCCGAACGTCTGGTAGCCGCACAT
CCGGAGTTCGAGTTGCTGTCCGTGCGCCGGGGCCTGCACCGCACTGACGACTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3080c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	RegulatedBy Rv3080c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006