Rv2244 - meromycolate extension acyl carrier protein acpM

Expression: Most Significant Conditions for Rv2244

Protein Domains

Gene Information
Locus	Rv2244
Symbol	acpM
Gene Name	meromycolate extension acyl carrier protein acpM
Location	2517771 - 2518118 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:348 bp Protein:116 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28372
Related Genes	Acel_0876 CE2148 cg2473 jk0659 MAP1997 MAV_2193 Mkms_3427 ML1654 Mmcs_3365 MSMEG_4326 MT2304 MUL_1305 Mvan_3755 nfa16160 PPA0982 SAV5786
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2244
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2244 Transcript 1
MPVTQEEIIAGIAEIIEEVTGIEPSEITPEKSFVDDLDIDSLSMVEIAVQTEDKYGVKIP
DEDLAGLRTVGDVVAYIQKLEEENPEAAQALRAKIESENPDAVANVQARLEAESK*

Genomic Sequence

>Rv2244
GTGCCTGTCACTCAGGAAGAAATCATTGCCGGTATCGCCGAGATCATCGAAGAGGTAACC
GGTATCGAGCCGTCCGAGATCACCCCGGAGAAGTCGTTCGTCGACGACCTGGACATCGAC
TCGCTGTCGATGGTCGAGATCGCCGTGCAGACCGAGGACAAGTACGGCGTCAAGATCCCC
GACGAGGACCTCGCCGGTCTGCGTACCGTCGGTGACGTTGTCGCCTACATCCAGAAGCTC
GAGGAAGAAAACCCGGAGGCGGCTCAGGCGTTGCGCGCGAAGATTGAGTCGGAGAACCCC
GATGCCGTTGCCAACGTTCAGGCGAGGCTTGAGGCCGAGTCCAAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Name	Acyl carrier protein	active	mjackson	2012-10-05
	FAS-I->FAS-II
Term	EC:2.3.1.38 [Acyl-carrier-protein] S-acetyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:2.3.1.39 [Acyl-carrier-protein] S-malonyltransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Term	EC:6.4.1.2 Acetyl-CoA carboxylase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005