Rv2347c - Esat-6 like protein esxP

Expression: Most Significant Conditions for Rv2347c

Protein Domains

Gene Information
Locus	Rv2347c
Symbol	esxP
Gene Name	Esat-6 like protein esxP
Location	2626223 - 2626519 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:297 bp Protein:99 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11459
Related Genes	MT2412
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2347c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2347c Transcript 1
MATRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMAQM
NQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS*

Genomic Sequence

>Rv2347c
ATGGCAACACGTTTTATGACGGATCCGCACGCGATGCGGGACATGGCGGGCCGTTTTGAG
GTGCACGCCCAGACGGTGGAGGACGAGGCTCGCCGGATGTGGGCGTCCGCGCAAAACATC
TCGGGCGCGGGCTGGAGTGGCATGGCCGAGGCGACCTCGCTAGACACCATGGCCCAGATG
AATCAGGCGTTTCGCAACATCGTGAACATGCTGCACGGGGTGCGTGACGGGCTGGTTCGC
GACGCCAACAACTACGAGCAGCAAGAGCAGGCCTCCCAGCAGATCCTCAGCAGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-05
	Co-Occurrence (Functional Linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-05
	Co-Occurrence (Functional Linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-05
	Co-Occurrence (Functional Linkage) Y. Feng,X. Yang,Z. Liu,Y. Liu,B. Su,Y. Ding,L. Qin,H. Yang,R. Zheng,Z. Hu Continuous treatment with recombinant Mycobacterium tuberculosis CFP-10-ESAT-6 protein activated human monocyte while deactivated LPS-stimulated macrophage. Biochem. Biophys. Res. Commun. 2008
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-05
	Co-Occurrence (Functional Linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-05
	Co-Occurrence (Functional Linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-05
	Co-Occurrence (Functional Linkage) Y. Feng,X. Yang,Z. Liu,Y. Liu,B. Su,Y. Ding,L. Qin,H. Yang,R. Zheng,Z. Hu Continuous treatment with recombinant Mycobacterium tuberculosis CFP-10-ESAT-6 protein activated human monocyte while deactivated LPS-stimulated macrophage. Biochem. Biophys. Res. Commun. 2008
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-03
	Co-Occurrence (Functional Linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-03
	Co-Occurrence (Functional Linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-03
	Co-Occurrence (Functional Linkage) Y. Feng,X. Yang,Z. Liu,Y. Liu,B. Su,Y. Ding,L. Qin,H. Yang,R. Zheng,Z. Hu Continuous treatment with recombinant Mycobacterium tuberculosis CFP-10-ESAT-6 protein activated human monocyte while deactivated LPS-stimulated macrophage. Biochem. Biophys. Res. Commun. 2008
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-03
	Co-Occurrence (Functional Linkage) KL. Lightbody, D. Ilghari et al. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. J. Biol. Chem. 2008
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-03
	Co-Occurrence (Functional Linkage) PA. Champion, SA. Stanley et al. C-terminal signal sequence promotes virulence factor secretion in Mycobacterium tuberculosis. Science 2006
Interaction	Signaling Rv2346c	active	jhum4u2006	2012-10-03
	Co-Occurrence (Functional Linkage) Y. Feng,X. Yang,Z. Liu,Y. Liu,B. Su,Y. Ding,L. Qin,H. Yang,R. Zheng,Z. Hu Continuous treatment with recombinant Mycobacterium tuberculosis CFP-10-ESAT-6 protein activated human monocyte while deactivated LPS-stimulated macrophage. Biochem. Biophys. Res. Commun. 2008