Rv2348c - hypothetical protein

Expression: Most Significant Conditions for Rv2348c

Protein Domains

Gene Information
Locus	Rv2348c
Symbol
Gene Name	hypothetical protein
Location	2626654 - 2626980 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:327 bp Protein:109 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9109
Related Genes	MAP2135c MAV_2040 MT2413
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2348c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2348c Transcript 1
MLLPLGPPLPPDAVVAKRAESGMLGGLSVPLSWGVAVPPDDYDHWAPAPEDGADVDVQAA
EGADAEAAAMDEWDEWQAWNEWVAENAEPRFEVPRSSSSVIPHSPAAG*

Genomic Sequence

>Rv2348c
GTGCTTTTGCCTCTTGGTCCGCCTTTGCCGCCCGACGCGGTGGTGGCGAAACGGGCTGAG
TCGGGAATGCTCGGCGGGTTGTCGGTTCCGCTCAGCTGGGGAGTGGCTGTGCCACCCGAT
GATTATGACCACTGGGCGCCTGCGCCGGAGGACGGCGCCGATGTCGATGTCCAGGCGGCC
GAAGGGGCGGACGCAGAGGCCGCGGCCATGGACGAGTGGGATGAGTGGCAGGCGTGGAAC
GAGTGGGTGGCGGAGAACGCTGAACCCCGCTTTGAGGTGCCACGGAGTAGCAGCAGCGTG
ATTCCGCATTCTCCGGCGGCCGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1221	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv3414c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	Regulatory Rv1221	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv3414c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001