Rv2361c - long-chain (C50)-Z-isoprenyl diphosphate synthase

Expression: Most Significant Conditions for Rv2361c

Protein Domains

Gene Information
Locus	Rv2361c
Symbol
Gene Name	long-chain (C50)-Z-isoprenyl diphosphate synthase
Location	2642578 - 2643468 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:891 bp Protein:297 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28285
Related Genes	Acel_0796 BL0101 CE2182 cg2508 DIP1712 jk0610 MAP2141c MAV_2034 Mkms_3512 ML0634 Mmcs_3449 MSMEG_4490 MT2430 MUL_3614 Mvan_3822 nfa14530 PPA0942 SAV5629
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2361c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2361c Transcript 1
MARDARKRTSSNFPQLPPAPDDYPTFPDTSTWPVVFPELPAAPYGGPCRPPQHTSKAAAP
RIPADRLPNHVAIVMDGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAF
STENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEM
TKSNDVITINYCVNYGGRTEITEATREIAREVAAGRLNPERITESTIARHLQRPDIPDVD
LFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA*

Genomic Sequence

>Rv2361c
GTGGCTAGGGATGCACGGAAGCGGACGTCCAGCAACTTCCCGCAGCTGCCTCCGGCCCCC
GACGACTACCCGACCTTTCCTGATACGTCGACGTGGCCCGTCGTCTTCCCGGAGTTGCCG
GCAGCGCCCTACGGAGGCCCCTGCCGGCCACCGCAGCACACTTCGAAAGCGGCCGCGCCA
CGAATACCGGCCGACCGGCTGCCCAACCATGTCGCCATTGTCATGGACGGCAATGGCCGC
TGGGCCACCCAACGTGGGCTGGCCCGCACCGAAGGTCACAAGATGGGCGAGGCGGTGGTG
ATCGACATCGCTTGCGGTGCTATCGAACTTGGGATCAAGTGGCTCAGCCTCTACGCCTTC
TCCACGGAGAACTGGAAGCGTTCGCCCGAGGAAGTCCGCTTCCTGATGGGCTTCAACCGC
GACGTGGTGCGACGGCGCCGAGACACCCTAAAGAAGCTAGGGGTCCGGATCCGGTGGGTG
GGTTCACGACCACGGCTGTGGCGTAGCGTCATCAATGAGTTGGCGGTCGCGGAGGAGATG
ACCAAAAGCAACGACGTCATCACCATCAACTATTGCGTCAACTACGGCGGACGCACCGAA
ATCACCGAAGCCACCCGCGAAATCGCTCGTGAGGTCGCCGCGGGCAGGCTCAACCCGGAG
CGGATCACCGAATCCACGATCGCCCGCCACCTGCAGCGACCCGACATTCCCGACGTTGAC
CTCTTCCTGCGGACCTCGGGTGAGCAGCGCTCCAGCAACTTCATGCTGTGGCAGGCGGCC
TACGCTGAATACATATTCCAGGACAAGCTCTGGCCCGACTATGACCGCCGCGACTTGTGG
GCGGCCTGCGAGGAATACGCGTCGCGCACTCGGCGGTTCGGGAGCGCCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	EC:2.5.1.31 diphosphate specific). - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	TBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Term	EC:2.5.1.31 diphosphate specific). - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Term	TBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	EC:2.5.1.31 diphosphate specific). - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	TBRXN:UDPDPS2 undecaprenyl-diphosphate synthase - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Term	EC:2.5.1.31 diphosphate specific). - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Term	TBRXN:UDPDPS undecaprenyl-diphosphate synthase - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	EC:2.5.1.31 diphosphate specific). - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	TBRXN:UDPDPS undecaprenyl-diphosphate synthase - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Term	EC:2.5.1.31 diphosphate specific). - ISS	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Term	TBRXN:UDPDPS undecaprenyl-diphosphate synthase - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	EC:2.5.1.31 diphosphate specific). - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 MC. Schulbach, PJ. Brennan et al. Identification of a short (C15) chain Z-isoprenyl diphosphate synthase and a homologous long (C50) chain isoprenyl diphosphate synthase in Mycobacterium tuberculosis. J. Biol. Chem. 2000
Term	TBRXN:UDPDPS undecaprenyl-diphosphate synthase - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Term	EC:2.5.1.31 diphosphate specific). - IDA	active	njamshidi	2012-10-05
	PMID: 15516568, 10816587 D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004
Name	Long (C50) chain Z-isoprenyl diphosphate synthase	active	mjackson	2012-10-05
	Prenyl diphosphate synthases
Symbol	uppS	active	mjackson	2012-10-05
	Prenyl diphosphate synthases
Term	EC:2.5.1.31 Di-trans,poly-cis-decaprenylcistransferase. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay D. Kaur, PJ. Brennan et al. Decaprenyl diphosphate synthesis in Mycobacterium tuberculosis. J. Bacteriol. 2004