Rv2382c - polyketide synthetase mbtC

Expression: Most Significant Conditions for Rv2382c

Protein Domains

Gene Information
Locus	Rv2382c
Symbol	mbtC
Gene Name	polyketide synthetase mbtC
Location	2670269 - 2671603 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1335 bp Protein:445 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26214
Related Genes	MAP2175c MAV_2011 Mkms_3531 Mmcs_3468 MSMEG_4513 MT2450 MUL_3637 Mvan_3847 nfa7640
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2382c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2382c Transcript 1
MSDNDPVVIVGLAIEAPGGVETADDYWTLLSEQREGLGPFPTDRGWALRELFDGSRRNGF
KPIHNLGGFLSSATTFDPEFFRISPREATAMDPQQRVGLRVAWRTLENSGINPDDLAGHD
VGCYVGASALEYGPALTEFSHHSGHLITGTSLGVISGRIAYTLDLAGPALTVDTSCSSAL
AAFHTAVQAIRAGDCDLALAGGVCVMGTPGYFVEFSKQHALSDDGHCRPYSAHASGTAWA
EGAAMFLLQRRSRATADRRRVLAEVRASCLNSDGLSDGLTAPSGDAQTRLLRRAIAQAAV
VPADVGMVEGHGTATRLGDRTELRSLAASYGTAPAGRGPLLGSVKSNIGHAQAAAGGLGL
VKVILAAQHAAIPPTLHVDEPSREIDWEKQGLRLADKLTPWRAVDGWRTAAVSAFGMSGT
NSHVIVSMPDTVSAPERGPECGEV*

Genomic Sequence

>Rv2382c
ATGTCCGATAACGACCCGGTCGTCATCGTCGGGCTGGCCATCGAGGCACCCGGTGGTGTC
GAAACCGCCGACGACTACTGGACACTGCTCTCCGAACAGCGCGAGGGACTCGGACCGTTC
CCCACCGATCGAGGTTGGGCACTTCGCGAGCTGTTCGACGGGTCGCGTCGAAACGGATTC
AAACCGATCCACAACCTTGGCGGATTCCTTTCCAGCGCAACTACATTCGATCCTGAGTTC
TTCCGCATCTCACCGCGCGAGGCGACGGCGATGGACCCGCAGCAGCGGGTGGGGCTGCGA
GTAGCATGGCGCACCCTGGAGAACAGCGGGATCAATCCCGATGACCTGGCCGGTCACGAT
GTGGGCTGTTATGTCGGTGCCTCGGCGCTCGAATACGGTCCCGCTTTGACCGAATTCTCC
CACCACAGTGGCCATCTGATCACCGGGACGTCGCTGGGTGTCATCTCCGGGCGCATCGCC
TACACCCTTGACCTGGCCGGGCCGGCGCTGACCGTCGATACCTCGTGTTCGTCGGCGCTG
GCGGCCTTTCACACCGCGGTTCAAGCTATCCGGGCCGGCGACTGCGACCTGGCACTCGCC
GGCGGCGTGTGCGTGATGGGTACGCCCGGCTATTTCGTCGAGTTCTCCAAGCAGCACGCG
CTATCCGACGACGGCCACTGCCGGCCCTACAGCGCGCACGCCAGCGGAACCGCCTGGGCA
GAGGGCGCCGCCATGTTCCTCCTGCAGCGCCGGTCGCGGGCAACCGCTGACCGGCGTCGT
GTCCTCGCCGAGGTGCGTGCCAGTTGCCTGAACTCCGATGGACTTAGCGACGGGCTGACC
GCGCCCAGCGGCGACGCGCAAACGCGACTGCTCCGGCGCGCCATCGCGCAGGCAGCAGTT
GTGCCCGCCGATGTCGGGATGGTCGAAGGGCACGGCACCGCGACCCGGCTCGGCGATCGC
ACCGAATTGCGGTCACTGGCAGCCAGCTACGGCACCGCCCCGGCCGGACGCGGGCCGCTG
TTGGGATCGGTCAAGTCAAACATCGGGCATGCTCAGGCGGCGGCGGGCGGGCTGGGCCTT
GTGAAGGTCATTCTGGCCGCCCAGCACGCCGCGATCCCGCCGACACTGCACGTCGACGAG
CCCAGCCGCGAAATCGATTGGGAGAAACAGGGTCTGCGGCTGGCCGACAAACTCACGCCG
TGGCGGGCCGTTGACGGATGGCGCACCGCGGCGGTGTCCGCGTTCGGGATGAGCGGTACC
AATAGCCACGTGATCGTTTCGATGCCGGACACCGTTTCCGCGCCCGAGCGTGGCCCCGAG
TGTGGGGAGGTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:MCBTS3 carboxymycobactin synthesis - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	TBRXN:MCBTS3 carboxymycobactin synthesis - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
Term	TBRXN:MCBTS2 mycobactin synthesis - IPI	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IPI	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	TBRXN:MCBTS2 mycobactin synthesis - ISS	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - ISS	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) GM. Rodriguez & I. Smith Mechanisms of iron regulation in mycobacteria: role in physiology and virulence. Mol. Microbiol. 2003
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999