Rv2389c - resuscitation-promoting factor rpfD

Expression: Most Significant Conditions for Rv2389c

Protein Domains

Gene Information
Locus	Rv2389c
Symbol	rpfD
Gene Name	resuscitation-promoting factor rpfD
Location	2683248 - 2683712 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:465 bp Protein:155 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22380
Related Genes	MT2458
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2389c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2389c Transcript 1
MTPGLLTTAGAGRPRDRCARIVCTVFIETAVVATMFVALLGLSTISSKADDIDWDAIAQC
ESGGNWAANTGNGLYGGLQISQATWDSNGGVGSPAAASPQQQIEVADNIMKTQGPGAWPK
CSSCSQGDAPLGSLTHILTFLAAETGGCSGSRDD*

Genomic Sequence

>Rv2389c
ATGACACCGGGTTTGCTTACTACTGCGGGTGCTGGCCGACCACGTGACAGGTGCGCCAGG
ATCGTATGCACGGTGTTCATCGAAACCGCCGTTGTCGCGACCATGTTTGTCGCGTTGTTG
GGTCTGTCCACCATCAGCTCGAAAGCCGACGACATCGATTGGGACGCCATCGCGCAATGC
GAATCCGGCGGCAATTGGGCGGCCAACACCGGTAACGGGTTATACGGTGGTCTGCAGATC
AGCCAGGCGACGTGGGATTCCAACGGTGGTGTCGGGTCGCCGGCGGCCGCGAGTCCCCAG
CAACAGATCGAGGTCGCAGACAACATTATGAAAACCCAAGGCCCGGGTGCGTGGCCGAAA
TGTAGTTCTTGTAGTCAGGGAGACGCACCGCTGGGCTCGCTCACCCACATCCTGACGTTC
CTCGCGGCCGAGACTGGAGGTTGTTCGGGGAGCAGGGACGATTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv2390c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) N. Casali & LW. Riley A phylogenomic analysis of the Actinomycetales mce operons. BMC Genomics 2007
Interaction	Regulatory Rv2450c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) KJ. Downing, JC. Betts et al. Global expression profiling of strains harbouring null mutations reveals that the five rpf-like genes of Mycobacterium tuberculosis show functional redundancy. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv1884c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) KJ. Downing, JC. Betts et al. Global expression profiling of strains harbouring null mutations reveals that the five rpf-like genes of Mycobacterium tuberculosis show functional redundancy. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv1009	active	sourish10	2012-10-05
	Co-expression (Functional linkage) KJ. Downing, JC. Betts et al. Global expression profiling of strains harbouring null mutations reveals that the five rpf-like genes of Mycobacterium tuberculosis show functional redundancy. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0867c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) KJ. Downing, JC. Betts et al. Global expression profiling of strains harbouring null mutations reveals that the five rpf-like genes of Mycobacterium tuberculosis show functional redundancy. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Name	Resuscitation-promoting factor	active	mjackson	2012-10-05
	Peptidoglycan turnover