Rv2397c - sulfate-transport ATP-binding protein ABC transporter cysA1

Expression: Most Significant Conditions for Rv2397c

Protein Domains

Gene Information
Locus	Rv2397c
Symbol	cysA1
Gene Name	sulfate-transport ATP-binding protein ABC transporter cysA1
Location	2693909 - 2694964 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1056 bp Protein:352 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37920
Related Genes	MAP2210c MAV_1785 Mkms_3542 Mmcs_3479 MSMEG_4530 MT2468 MUL_3658 Mvan_3872 nfa14070
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2397c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2397c Transcript 1
MTYAIVVADATKRYGDFVALDHVDFVVPTGSLTALLGPSGSGKSTLLRTIAGLDQPDTGT
ITINGRDVTRVPPQRRGIGFVFQHYAAFKHLTVRDNVAFGLKIRKRPKAEIKAKVDNLLQ
VVGLSGFQSRYPNQLSGGQRQRMALARALAVDPEVLLLDEPFGALDAKVREELRAWLRRL
HDEVHVTTVLVTHDQAEALDVADRIAVLHKGRIEQVGSPTDVYDAPANAFVMSFLGAVST
LNGSLVRPHDIRVGRTPNMAVAAADGTAGSTGVLRAVVDRVVVLGFEVRVELTSAATGGA
FTAQITRGDAEALALREGDTVYVRATRVPPIAGGVSGVDDAGVERVKVTST*

Genomic Sequence

>Rv2397c
ATGACCTACGCCATCGTCGTGGCCGACGCCACCAAACGCTACGGCGACTTCGTCGCACTT
GACCACGTGGATTTCGTCGTACCGACCGGTTCGCTGACCGCATTGTTGGGCCCCAGCGGT
TCGGGCAAGTCGACGCTGTTGCGCACCATAGCCGGCCTCGACCAACCGGACACCGGAACC
ATCACGATCAACGGCCGCGACGTCACCCGGGTGCCGCCACAGCGGCGTGGCATCGGATTC
GTCTTCCAGCACTACGCGGCGTTCAAACACCTGACTGTCCGTGACAACGTGGCGTTCGGG
TTGAAGATCCGTAAGCGCCCCAAGGCCGAGATCAAGGCCAAGGTCGACAATCTGCTGCAG
GTGGTGGGCCTGAGCGGATTTCAGAGCCGCTACCCCAATCAGCTCTCCGGTGGGCAACGA
CAGCGGATGGCGCTGGCCAGGGCGCTGGCGGTCGATCCGGAGGTGCTGCTGCTCGACGAG
CCGTTCGGCGCACTCGATGCCAAGGTGCGCGAAGAGCTGCGTGCCTGGCTGCGCCGCCTG
CACGACGAGGTGCATGTCACCACGGTGCTGGTCACCCACGATCAGGCCGAAGCGCTGGAT
GTGGCCGACCGCATCGCCGTACTCCACAAGGGCCGTATCGAGCAGGTCGGATCCCCGACC
GACGTTTACGACGCCCCGGCGAACGCCTTCGTGATGTCCTTCTTGGGAGCGGTTTCCACG
TTGAACGGCTCCCTGGTGCGCCCGCACGACATCCGGGTCGGCCGGACTCCCAATATGGCC
GTGGCCGCCGCTGACGGCACCGCCGGGTCCACCGGTGTGCTACGGGCTGTTGTGGATCGG
GTGGTGGTGCTGGGCTTCGAGGTCCGCGTGGAGTTGACCAGCGCGGCCACCGGCGGGGCC
TTCACCGCCCAGATCACCCGCGGCGATGCCGAGGCGCTGGCCCTACGCGAGGGTGACACC
GTCTACGTGCGTGCCACCCGGGTGCCGCCGATTGCCGGTGGCGTATCGGGCGTCGACGAT
GCCGGCGTGGAACGGGTCAAAGTCACATCGACGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:SULabc sulfate transport via ABC system - ISS	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Term	TBRXN:SULabc sulfate transport via ABC system - IDA	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Interaction	PhysicalInteraction Rv2400c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2400c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	vashishtrv	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	shahanup86	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002