Rv2399c - sulfate-transport membrane protein ABC transporter cysT

Expression: Most Significant Conditions for Rv2399c

Protein Domains

Gene Information
Locus	Rv2399c
Symbol	cysT
Gene Name	sulfate-transport membrane protein ABC transporter cysT
Location	2695796 - 2696647 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:852 bp Protein:284 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37823
Related Genes	MAP2212c MAV_1783 Mkms_3544 Mmcs_3481 MSMEG_4532 MT2470 MUL_3660 Mvan_3874 nfa14050
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2399c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2399c Transcript 1
MTESLVGERRAPQFRARLSGPAGPPSVRVGMAVVWLSVIVLLPLAAIVWQAAGGGWRAFW
LAVSSHAAMESFRVTLTISTAVTVINLVFGLLIAWVLVRDDFAGKRIVDAIIDLPFALPT
IVASLVMLALYGNNSPVGLHFQHTATGVGVALAFVTLPFVVRAVQPVLLEIDRETEEAAA
SLGANGAKIFTSVVLPSLTPALLSGAGLAFSRAIGEFGSVVLIGGAVPGKTEVSSQWIRT
LIENDDRTGAAAISVVLLSISFIVLLILRVVGARAAKREEMAA*

Genomic Sequence

>Rv2399c
ATGACGGAATCGTTGGTCGGCGAACGCCGCGCGCCGCAGTTCCGCGCGCGCCTTTCCGGC
CCCGCGGGCCCCCCTTCCGTTCGGGTCGGTATGGCAGTGGTGTGGCTTTCGGTGATCGTG
CTGTTGCCGCTGGCCGCCATCGTCTGGCAGGCCGCGGGCGGTGGTTGGCGGGCCTTCTGG
CTGGCGGTCTCGTCGCATGCCGCGATGGAGTCGTTCCGGGTAACGCTGACGATTTCGACC
GCAGTCACGGTCATCAACCTGGTGTTCGGCTTGCTGATCGCCTGGGTGCTGGTGCGTGAC
GACTTCGCTGGCAAGCGGATCGTCGATGCGATTATCGATCTGCCGTTTGCGTTGCCCACC
ATCGTCGCCAGCCTGGTGATGTTGGCACTGTACGGGAACAACAGCCCGGTGGGGCTTCAT
TTTCAACACACCGCGACCGGTGTTGGGGTGGCGTTGGCGTTCGTCACATTGCCGTTCGTG
GTGCGCGCCGTGCAGCCGGTGCTGCTGGAAATCGATCGCGAGACCGAGGAGGCGGCGGCG
TCGCTGGGCGCTAATGGTGCCAAAATCTTCACTTCGGTGGTGTTGCCGTCGCTGACGCCG
GCATTGTTATCCGGTGCGGGCCTGGCGTTTTCGCGCGCTATCGGCGAGTTCGGTTCGGTG
GTTCTGATCGGCGGGGCCGTGCCGGGCAAGACCGAGGTGTCCTCGCAATGGATTCGCACC
CTGATCGAGAACGACGACCGCACCGGAGCGGCCGCGATATCGGTTGTATTGCTCTCGATT
TCGTTCATTGTGCTGCTCATCCTACGTGTCGTCGGCGCGCGTGCGGCCAAACGTGAGGAG
ATGGCCGCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:SULabc sulfate transport via ABC system - ISS	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Term	TBRXN:SULabc sulfate transport via ABC system - IDA	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Interaction	PhysicalInteraction Rv2400c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2400c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2397c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	vashishtrv	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	shahanup86	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002