Rv2431c - PE family protein

Expression: Most Significant Conditions for Rv2431c

Protein Domains

Gene Information
Locus	Rv2431c
Symbol	PE25
Gene Name	PE family protein
Location	2727967 - 2728266 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:300 bp Protein:100 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9120
Related Genes	MT2506
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2431c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2431c Transcript 1
MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYAR
KYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS*

Genomic Sequence

>Rv2431c
ATGTCTTTTGTGATCACAAATCCCGAGGCGTTGACCGTGGCGGCCACGGAGGTACGACGG
ATTCGCGATCGTGCGATCCAAAGCGATGCTCAGGTGGCCCCGATGACAACCGCTGTGCGG
CCTCCGGCTGCGGATCTGGTGTCGGAGAAGGCGGCGACGTTCCTGGTCGAGTACGCAAGG
AAGTATCGGCAGACCATCGCTGCGGCGGCGGTGGTTCTTGAGGAGTTTGCGCACGCCTTG
ACCACTGGCGCCGATAAGTATGCGACCGCCGAGGCCGACAACATCAAGACCTTTAGTTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Structural Analysis authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv2430c	active	singhpankaj2116	2012-10-05
	Spectrophotometric authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2077c	active	sourish10	2012-10-05
	Gene neighbourhood (Functional linkage) S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2077c	active	ahal4789	2012-10-05
	Gene neighbourhood (Functional linkage) S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Symbol	PPE41	active	jlew	2012-03-07
	PPE25 and PPE41 interact. Using an in vivo pull-down assay, for the first time we have confirmed the presence of three pairs of PE/PPE-related novel protein interactions in this pathogen. J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010