Rv2491 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2491

Protein Domains

Gene Information
Locus	Rv2491
Symbol
Gene Name	conserved hypothetical protein
Location	2806665 - 2807288 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:624 bp Protein:208 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	14022
Related Genes	MT2566 nfa30040
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2491
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2491 Transcript 1
MVDTSAPASRLDTDPRRAHVSLSKHPYQIGVFGSGTIGPRVYELAYQVGAEIAKQGHILI
SGGMTGTMEASSRGASDADGLVVGVLPGDKFTDGNAYSTIKILSGMQFARNYITGLSCHG
AIVVGGSSGAYEEARRVWEGRGPVVVLANSGSPTGASAQMLSMQEIFGVAFPEDKPKPWR
VFSAATPAESVSLVIGLIRKGYAQHEP*

Genomic Sequence

>Rv2491
ATGGTCGACACGAGCGCGCCCGCCAGCCGGCTGGACACCGATCCGCGCCGCGCTCATGTG
AGTCTTAGTAAGCACCCCTACCAGATTGGAGTTTTCGGGTCCGGAACAATTGGTCCGAGA
GTCTACGAACTGGCCTATCAAGTCGGTGCCGAGATCGCAAAGCAAGGCCACATTCTCATC
AGTGGCGGGATGACTGGCACAATGGAAGCCTCCTCACGGGGTGCGTCGGACGCCGACGGC
CTTGTCGTCGGCGTCCTGCCGGGCGACAAGTTTACCGATGGCAATGCCTATTCCACGATA
AAGATTCTGAGCGGTATGCAGTTTGCTCGTAACTACATAACAGGTTTGAGCTGCCACGGA
GCAATTGTCGTCGGCGGCTCGAGCGGCGCCTATGAAGAAGCCCGTCGTGTCTGGGAAGGC
CGTGGCCCCGTGGTGGTTCTAGCGAACAGCGGATCGCCAACGGGTGCGTCTGCGCAAATG
CTGTCCATGCAGGAAATCTTTGGGGTCGCCTTTCCGGAGGACAAACCCAAGCCCTGGCGA
GTCTTTTCGGCGGCAACCCCCGCCGAATCGGTGTCGCTTGTCATTGGCCTGATCCGGAAA
GGATATGCCCAACATGAGCCGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2494	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2494	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2494	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	PhysicalInteraction Rv2494	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2493	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007
Interaction	PhysicalInteraction Rv2492	active	vmevada102	2012-10-05
	Co-occurrence (Functional linkage) authors,J. Becq,MC. Gutierrez,V. Rosas-Magallanes,J. Rauzier,B. Gicquel,O. Neyrolles,P. Deschavanne Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Mol. Biol. Evol. 2007