Rv2549c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2549c

Protein Domains

Gene Information
Locus	Rv2549c
Symbol
Gene Name	conserved hypothetical protein
Location	2869727 - 2870122 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:396 bp Protein:132 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9147
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2549c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2549c Transcript 1
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAA
AAIRLSTVVRVEHVTADLEEQAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDF
SAAGFVEVRPE*

Genomic Sequence

>Rv2549c
ATGATCTTCGTCGACACGTCCTTCTGGGCTGCACTTGGCAACGCCGGCGACGCTCGGCAC
GGCACCGCGAAGAGGTTGTGGGCCAGCAAACCGCCCGTGGTGATGACCTCCAACCATGTC
CTGGGCGAGACCTGGACGCTGCTCAACCGGCGCTGCGGTCACCGCGCGGCGGTTGCCGCC
GCTGCAATCCGCTTGAGCACCGTCGTTCGCGTCGAGCACGTAACAGCCGACCTGGAAGAG
CAGGCATGGGAATGGCTTGTACGCCACGACGAGCGAGAGTACTCGTTCGTCGATGCCACG
AGCTTCGCGGTGATGCGAAAGAAAGGCATCCAAAATGCGTATGCCTTCGATGGTGACTTC
AGCGCGGCCGGATTTGTCGAGGTAAGACCCGAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv2550c	active	gaurisd10	2012-10-05
	Structural Analysis authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibition Rv2550c	active	gaurisd10	2012-10-05
	Structural Analysis authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibition Rv2550c	active	gaurisd10	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibition Rv2550c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibition Rv2550c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibition Rv2550c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv2550c	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2550c	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapC-mt20	active	jlew	2012-03-07
	Expression resulted in growth arrest in E coli. Expressed 23 VapC toxins in EC lacking TA modules. 4 inhibited growth. authors,JD. Sharp,JW. Cruz,S. Raman,M. Inouye,RN. Husson,NA. Woychik Growth and translation inhibition through sequence specific RNA binding by a mycobacterium tuberculosis VAPC toxin. The Journal of biological chemistry 2012
Symbol	VapC	active	jlew	2012-03-07
	Growth inhibitory in Mt and MS. In MS, not rescued by Rv0596c or Rv2830c. Rv2549c interacts with Rv2550c but not the other 3 VapBs, by Y2H. authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC20	active	jlew	2012-03-07
	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	VNG0072H from Halobacterium sp. strain NRC-1 (144 aa), FASTA scores: opt: 113, E(): 0.29,(25.75% identity in 136 aa overlap)
Other	stop:2870122	active	rslayden	2012-03-05
	VNG0072H from Halobacterium sp. strain NRC-1 (144 aa), FASTA scores: opt: 113, E(): 0.29,(25.75% identity in 136 aa overlap)
Other	start:2869727	active	rslayden	2012-03-05
	VNG0072H from Halobacterium sp. strain NRC-1 (144 aa), FASTA scores: opt: 113, E(): 0.29,(25.75% identity in 136 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	VNG6166H from Halobacterium sp. plasmid pNRC200 strain NRC-1 (144 aa),FASTA scores: opt: 133, E(): 0.011, (29.6% identity in 125aa overlap); and Q9HSU3
Other	stop:2870122	active	rslayden	2012-03-05
	VNG6166H from Halobacterium sp. plasmid pNRC200 strain NRC-1 (144 aa),FASTA scores: opt: 133, E(): 0.011, (29.6% identity in 125aa overlap); and Q9HSU3
Other	start:2869727	active	rslayden	2012-03-05
	VNG6166H from Halobacterium sp. plasmid pNRC200 strain NRC-1 (144 aa),FASTA scores: opt: 133, E(): 0.011, (29.6% identity in 125aa overlap); and Q9HSU3
Other	strand:+	active	rslayden	2012-03-05
	SLL1715 from Synechocystis sp. strain PCC 6803 (157aa), FASTA scores: opt: 167, E(): 4.2e-05, (29.45% identity in 129 aa overlap); Q9HHY6
Other	stop:2870122	active	rslayden	2012-03-05
	SLL1715 from Synechocystis sp. strain PCC 6803 (157aa), FASTA scores: opt: 167, E(): 4.2e-05, (29.45% identity in 129 aa overlap); Q9HHY6
Other	start:2869727	active	rslayden	2012-03-05
	SLL1715 from Synechocystis sp. strain PCC 6803 (157aa), FASTA scores: opt: 167, E(): 4.2e-05, (29.45% identity in 129 aa overlap); Q9HHY6
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to P73415
Other	stop:2870122	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to P73415
Other	start:2869727	active	rslayden	2012-03-05
	Conserved hypothetical protein, showing some similarity to P73415