Rv2564 - glutamine-transport ATP-binding protein ABC transporter glnQ

Expression: Most Significant Conditions for Rv2564

Protein Domains

Gene Information
Locus	Rv2564
Symbol	glnQ
Gene Name	glutamine-transport ATP-binding protein ABC transporter glnQ
Location	2883342 - 2884334 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:993 bp Protein:331 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37388
Related Genes	BL0525 BL0528 DIP2127 MAP1087 MAP1088 MAP1089 MAP1090 MAV_3418 MAV_3419 MAV_3420 Mkms_1891 Mmcs_1844 MSMEG_2844 MSMEG_2845 MSMEG_2846 MSMEG_4099 MT2640 nfa21380 nfa21390 nfa21430 nfa21470 nfa21480
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2564
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2564 Transcript 1
MGGLTISDLVVEYSSGGYAVRPIDGLSLDVAPGSLVILLGPSGCGKTTLLSCLGGILRPK
SGSIKFDDVDITTLEGAALAKYRRDKVGIVFQAFNLVSSLTALENVMVPLRAAGVSRAAA
RKRAEDLLIRVNLGERMKHRPGDMSGGQQQRVAVARAIALDPQLILADEPTAHLDFIQVE
EVLRLIRSLAQGDRVVVVATHDSRMLPLADRVLELMPAQVSPNQPPETVHVKAGEVLFEQ
STMGDLIYVVSEGEFEIVRELADGGEELVKTAAPGDYFGEIGVLFHLPRSATVRARSDAT
AVGYTAQAFRERLGVTRVADLIEHRELASE*

Genomic Sequence

>Rv2564
ATGGGCGGCCTAACCATTTCCGACCTGGTCGTCGAGTATTCCAGCGGCGGGTACGCCGTG
CGGCCGATCGACGGGTTAAGCCTCGACGTGGCGCCGGGGTCGCTGGTGATCTTGCTTGGG
CCCAGCGGCTGCGGGAAGACGACCCTCTTGTCCTGCCTCGGCGGCATCCTGCGCCCGAAG
TCCGGCTCAATCAAGTTTGACGATGTCGACATCACGACGCTGGAGGGCGCCGCGCTGGCG
AAGTATCGGCGTGACAAGGTAGGGATCGTCTTCCAGGCGTTCAACCTGGTCTCGAGCCTT
ACCGCCCTGGAGAACGTGATGGTCCCGCTGCGCGCGGCCGGCGTGTCACGAGCGGCCGCG
CGTAAGCGTGCCGAGGACCTGCTGATCCGAGTCAATCTCGGCGAACGAATGAAACACCGC
CCGGGTGACATGAGCGGCGGCCAGCAGCAACGCGTCGCGGTCGCCCGCGCGATCGCGCTG
GACCCGCAATTGATCCTTGCCGACGAACCGACCGCGCACCTGGACTTCATCCAGGTGGAG
GAGGTGCTGCGGCTGATCCGCTCGCTAGCGCAGGGCGACCGTGTGGTGGTGGTCGCGACC
CACGACAGCCGGATGCTGCCGCTGGCCGATCGCGTCCTTGAGCTGATGCCGGCGCAGGTG
TCGCCGAATCAGCCACCCGAAACGGTGCACGTGAAAGCCGGCGAGGTGCTGTTCGAGCAG
TCCACAATGGGCGATCTGATCTACGTGGTGTCCGAGGGCGAGTTCGAGATTGTGCGCGAA
TTGGCCGACGGCGGTGAGGAATTGGTCAAAACCGCCGCGCCTGGGGACTACTTCGGTGAA
ATCGGCGTGCTGTTTCACCTGCCACGCTCGGCAACGGTACGGGCTCGCAGCGACGCGACA
GCCGTCGGTTATACGGCGCAGGCGTTTCGGGAGCGGCTGGGTGTGACGCGGGTGGCCGAC
CTGATTGAGCACCGCGAGCTTGCCAGCGAATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Structural Analysis authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Structural Analysis authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Structural Analysis authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Structural Analysis authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Structural Analysis authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Structural Analysis authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Spectrophotometric authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Spectrophotometric authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,HS. Garmory,RW. Titball ATP-binding cassette transporters are targets for the development of antibacterial vaccines and therapies. Infect. Immun. 2004
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Spectrophotometric authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Spectrophotometric authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,L. Nguyen,A. Walburger,E. Houben,A. Koul,S. Muller,M. Morbitzer,B. Klebl,G. Ferrari,J. Pieters Role of protein kinase G in growth and glutamine metabolism of Mycobacterium bovis BCG. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv0411c	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv0073	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv0072	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Structural Analysis authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,IC. Sutcliffe,DJ. Harrington Lipoproteins of Mycobacterium tuberculosis: an abundant and functionally diverse class of cell envelope components. FEMS Microbiol. Rev. 2004
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,M. Braibant,P. Gilot,J. Content The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. FEMS Microbiol. Rev. 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric HG. Wiker,MA. Wilson,GK. Schoolnik Extracytoplasmic proteins of Mycobacterium tuberculosis - mature secreted proteins often start with aspartic acid and proline. Microbiology (Reading, Engl.) 2000
Interaction	PhysicalInteraction Rv2563	active	gaurisd10	2012-10-05
	Spectrophotometric authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
Interaction	Signaling Rv1354c	active	jgalag	2012-10-05
	Yeast two-hybrid (Physical interaction) T. Cui, L. Zhang et al. Uncovering new signaling proteins and potential drug targets through the interactome analysis of Mycobacterium tuberculosis. BMC Genomics 2009
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006