Rv2592c - holliday junction DNA helicase ruvB

Expression: Most Significant Conditions for Rv2592c

Protein Domains

Gene Information
Locus	Rv2592c
Symbol	ruvB
Gene Name	holliday junction DNA helicase ruvB
Location	2923199 - 2924233 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1035 bp Protein:345 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	712
Related Genes	Acel_1343 BL0729 CE1773 cg1869 DIP1375 jk1054 MAP1038 MAV_3473 Mkms_2314 ML0483 Mmcs_2267 MSMEG_2945 MT2669 MUL_1716 Mvan_2575 nfa36950 PPA1160 SAV6835
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2592c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2592c Transcript 1
MTERSDRDVSPALTVGEGDIDVSLRPRSLREFIGQPRVREQLQLVIEGAKNRGGTPDHIL
LSGPPGLGKTSLAMIIAAELGSSLRVTSGPALERAGDLAAMLSNLVEHDVLFIDEIHRIA
RPAEEMLYLAMEDFRVDVVVGKGPGATSIPLEVAPFTLVGATTRSGALTGPLRDRFGFTA
HMDFYEPAELERVLARSAGILGIELGADAGAEIARRSRGTPRIANRLLRRVRDFAEVRAD
GVITRDVAKAALEVYDVDELGLDRLDRAVLSALTRSFGGGPVGVSTLAVAVGEEAATVEE
VCEPFLVRAGMVARTPRGRVATALAWTHLGMTPPVGASQPGLFE*

Genomic Sequence

>Rv2592c
ATGACCGAGCGGTCCGACCGCGACGTTTCGCCCGCACTCACCGTCGGAGAGGGCGACATC
GACGTCAGCCTGCGGCCGCGCTCGTTACGCGAATTCATCGGCCAGCCCCGGGTCCGCGAA
CAGCTGCAGCTGGTCATCGAGGGAGCCAAAAACCGCGGCGGCACACCGGATCACATTCTG
CTGTCCGGTCCGCCGGGCTTGGGCAAGACGTCGTTGGCGATGATCATCGCCGCCGAGCTG
GGGTCCTCGCTGCGGGTGACGTCGGGGCCGGCGTTGGAACGCGCCGGTGACCTGGCGGCG
ATGCTGTCCAACCTGGTCGAGCACGACGTGTTGTTTATCGACGAGATCCACCGCATCGCC
CGGCCCGCCGAGGAGATGCTGTATCTGGCGATGGAAGACTTCCGCGTCGATGTGGTGGTC
GGCAAAGGTCCTGGGGCCACGTCGATTCCGCTGGAGGTCGCGCCGTTCACCCTGGTCGGG
GCGACTACCCGGTCGGGCGCGTTGACCGGCCCGCTGCGCGACCGGTTCGGCTTCACCGCG
CACATGGATTTCTACGAGCCCGCCGAGCTGGAGCGGGTGCTGGCCCGCTCCGCCGGAATT
CTGGGTATCGAGCTGGGCGCCGACGCCGGCGCCGAAATCGCCCGCCGTTCTCGGGGAACG
CCGCGGATCGCCAACCGGTTGTTGCGCCGGGTGCGTGACTTCGCCGAGGTGCGCGCCGAC
GGCGTCATCACCCGCGACGTCGCCAAGGCCGCACTGGAGGTCTACGACGTCGACGAGCTG
GGTCTGGACCGGCTGGACCGAGCGGTGCTCTCGGCGCTGACCCGCAGCTTCGGCGGTGGT
CCAGTGGGTGTGTCGACGCTGGCGGTGGCGGTCGGGGAGGAGGCCGCCACGGTCGAGGAG
GTGTGCGAACCATTTCTGGTGCGCGCGGGTATGGTCGCGCGCACCCCGCGCGGCCGGGTG
GCCACCGCCCTGGCCTGGACGCACCTGGGCATGACGCCACCGGTCGGAGCGAGTCAACCG
GGGTTGTTCGAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2603c	active	sureshks89	2012-10-05
	authors,MY. Galperin,EV. Koonin From complete genome sequence to 'complete' understanding? Trends Biotechnol. 2010
Interaction	PhysicalInteraction Rv2603c	active	sureshks89	2012-10-05
	authors,H. Liang,L. Li,Z. Dong,MG. Surette,K. Duan The YebC family protein PA0964 negatively regulates the Pseudomonas aeruginosa quinolone signal system and pyocyanin production. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05
	DNA Replication Fork Reversal Catalyzed by RuvAB Proteins functionally characterized