Rv2668 - exported alanine and valine rich protein

Expression: Most Significant Conditions for Rv2668

Protein Domains

Gene Information
Locus	Rv2668
Symbol
Gene Name	exported alanine and valine rich protein
Location	2984733 - 2985254 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:522 bp Protein:174 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	6525
Related Genes	MAP2788 MAV_3560 Mkms_2268 Mmcs_2222 MSMEG_2790 MT2742 MUL_3302 Mvan_2493
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2668
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2668 Transcript 1
MRHWLIVLATLLVAAAGVAAANDVPRAWAGDAPIGHIGDTLRVDTGTYVADVTVSSVVPV
DPPPGFGYTRSGVPVKSFPDSSVTRADVTVRAVRVPNSFILATNFSFTGVTPFADAYKPR
PCDASDWLDAALGNAPQGSIVRGGVYWDAYRDPVSVVVLLDEKTGQHLAQWNL*

Genomic Sequence

>Rv2668
ATGCGCCACTGGCTGATCGTCCTCGCTACGCTGCTCGTCGCCGCCGCGGGCGTTGCGGCC
GCCAACGACGTGCCCCGTGCGTGGGCCGGCGACGCGCCGATCGGCCACATCGGCGACACG
CTGCGTGTGGACACCGGCACCTACGTCGCCGACGTCACCGTCAGCAGCGTCGTACCGGTC
GATCCGCCGCCGGGATTTGGCTATACCCGCAGCGGCGTCCCGGTCAAAAGCTTCCCCGAC
AGCTCAGTGACCCGCGCCGACGTGACGGTCCGCGCGGTCCGGGTGCCCAACTCCTTCATC
TTGGCCACCAATTTCAGCTTCACCGGAGTAACGCCGTTTGCCGACGCGTACAAGCCGCGG
CCGTGCGACGCATCCGATTGGCTCGACGCCGCGTTGGGCAACGCGCCACAGGGCTCGATC
GTTCGCGGCGGGGTGTACTGGGACGCCTACCGCGACCCGGTGTCGGTTGTCGTGCTGCTG
GACGAGAAAACCGGCCAGCACCTCGCACAGTGGAACCTTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	shruti4rana	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	M.smegmatis orthology based inference. Orthologous pair regulator-target found in M.smegmatis. SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003