Rv2717c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2717c

Protein Domains

Gene Information
Locus	Rv2717c
Symbol
Gene Name	conserved hypothetical protein
Location	3029867 - 3030361 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:495 bp Protein:165 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	28135
Related Genes	CE1476 MAP2833c MAV_3611 ML1006 Mmcs_0421 MSMEG_6574 MT2790 MUL_3360 Mvan_0449 nfa41140 SAV1365
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2717c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2717c Transcript 1
MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVAD
GKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVTGDVIELELSTRADGSIGLAP
TAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR*

Genomic Sequence

>Rv2717c
ATGACCCGAGATCTGGCCCCTGCCCTGCAGGCGCTGTCACCCCTCCTGGGGAGTTGGGCG
GGTCGCGGTGCGGGCAAGTACCCCACCATCCGGCCGTTCGAATACCTCGAGGAAGTCGTA
TTCGCCCATGTGGGTAAACCGTTTCTGACGTACACACAGCAGACCAGGGCGGTAGCTGAC
GGGAAGCCGCTGCATTCCGAGACGGGGTATCTCCGCGTTTGCCGACCGGGCTGCGTTGAA
CTCGTTCTCGCCCATCCAAGCGGCATCACCGAAATTGAGGTTGGAACCTATTCGGTGACC
GGTGACGTCATCGAACTCGAATTGTCCACACGCGCGGATGGGTCGATCGGATTGGCCCCG
ACCGCAAAAGAGGTGACCGCCCTTGACCGTTCCTACCGCATCGACGGCGACGAGCTTTCG
TACTCGTTGCAGATGCGCGCGGTCGGGCAACCCCTGCAGGATCACCTTGCCGCCGTGTTG
CATCGGCAGCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006