Rv2719c - conserved membrane protein

Expression: Most Significant Conditions for Rv2719c

Protein Domains

Gene Information
Locus	Rv2719c
Symbol
Gene Name	conserved membrane protein
Location	3031040 - 3031537 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:498 bp Protein:166 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	3977
Related Genes	MAP2835c MAV_3613 Mkms_2215 ML1004 Mmcs_2169 MSMEG_2742 MT2792 MUL_3362 Mvan_2442
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2719c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2719c Transcript 1
MTPVRPPHTPDPLNLRGPLDGPRWRRAEPAQSRRPGRSRPGGAPLRYHRTGVGMSRTGHG
SRPVPPATTVGLALLAAAITLWLGLVAQFGQMITGGSADGSADSTGRVPDRLAVVRVETG
ESLYDVAVRVAPNAPTRQVADRIRELNGLQTPALAVGQTLIAPVG*

Genomic Sequence

>Rv2719c
ATGACACCGGTCCGGCCACCGCATACCCCCGATCCGCTCAATCTGCGGGGCCCGCTCGAT
GGACCTCGCTGGCGCCGCGCTGAGCCGGCGCAATCGCGCAGGCCCGGCCGATCGAGGCCG
GGGGGTGCGCCGCTGCGCTACCACCGCACCGGGGTCGGGATGTCGAGGACTGGGCATGGC
AGCAGGCCCGTCCCGCCGGCCACGACGGTGGGGCTGGCTCTGCTTGCCGCGGCGATTACT
CTCTGGCTTGGTTTGGTGGCGCAGTTCGGGCAGATGATCACCGGCGGTTCGGCCGACGGG
TCGGCCGATTCGACCGGTCGGGTGCCCGACAGGCTTGCCGTGGTACGGGTGGAAACGGGG
GAGTCCCTGTATGACGTGGCGGTCCGGGTGGCGCCGAACGCTCCGACCCGCCAGGTTGCC
GACCGCATCCGTGAACTCAACGGCCTGCAGACACCGGCATTGGCCGTGGGTCAGACGCTG
ATCGCTCCGGTTGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2720	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Regulatory Rv2720	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Regulatory Rv2720	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Regulatory Rv2720	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2720	active	ahal4789	2012-10-05
	operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2720	active	ahal4789	2012-10-05
	operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2720	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2720	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2718c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	Hydrolase involved with regulation of cell division	active	mjackson	2012-10-05
	Cell division
Symbol	chiZ	active	mjackson	2012-10-05
	Cell division
Name	Hydrolase involved with regulation of cell division	active	mjackson	2012-10-05
	Cell division
Symbol	chiZ	active	mjackson	2012-10-05
	Cell division
Name	cell wall hydrolase	active	rslayden	2012-03-05
	ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Symbol	ChiZ	active	rslayden	2012-03-05
	ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Name	cell wall hydrolase	active	rslayden	2012-03-05
	ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan ChiZ levels modulate cell division process in mycobacteria. Tuberculosis (Edinb) 2011
Symbol	ChiZ	active	rslayden	2012-03-05
	ChiZ lead to decreased viability, loss of membrane integrity and defects in FtsZ-GFP localization and cell division. response to DNA damaging agents and exposure to cephalexin authors,IS. Vadrevu,H. Lofton,K. Sarva,E. Blasczyk,R. Plocinska,J. Chinnaswamy,M. Madiraju,M. Rajagopalan ChiZ levels modulate cell division process in mycobacteria. Tuberculosis (Edinb) 2011
Other	TBPWY:Other potential DNA repair genes	active	vmizrahi	2012-03-05
Other	TBPWY:Other potential DNA repair genes	active	vmizrahi	2012-03-05
	Highly DNA damage-inducible and also induced by hydrogen peroxide stress