Rv2736c - regulatory protein recX

Expression: Most Significant Conditions for Rv2736c

Protein Domains

Gene Information
Locus	Rv2736c
Symbol	recX
Gene Name	regulatory protein recX
Location	3048562 - 3049086 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:525 bp Protein:175 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	740
Related Genes	Acel_1491 BL1416 CE1848 cg2140 DIP1449 jk1115 MAP2847c MAV_3626 Mkms_2194 ML0988 Mmcs_2148 MSMEG_2724 MT2805 MUL_3379 Mvan_2421 nfa38410 PPA1013 SAV2491
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2736c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2736c Transcript 1
MTVSCPPPSTSEREEQARALCLRLLTARSRTRAELAGQLAKRGYPEDIGNRVLDRLAAVG
LVDDTDFAEQWVQSRRANAAKSKRALAAELHAKGVDDDVITTVLGGIDAGAERGRAEKLV
RARLRREVLIDDGTDEARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV*

Genomic Sequence

>Rv2736c
ATGACGGTGTCCTGCCCGCCCCCGTCGACTTCTGAGCGCGAAGAGCAGGCGCGGGCACTG
TGCCTGCGCCTGCTCACCGCGCGATCCCGCACCCGCGCCGAGTTAGCCGGCCAGCTGGCC
AAGCGCGGCTACCCCGAAGACATCGGCAACCGGGTATTGGATCGGCTGGCCGCCGTTGGC
CTGGTGGATGACACCGACTTCGCCGAACAATGGGTTCAGTCCAGGCGGGCGAACGCAGCA
AAGAGCAAGCGCGCGTTGGCTGCCGAGCTGCACGCCAAGGGCGTCGACGACGACGTGATC
ACCACGGTGCTCGGGGGCATCGACGCCGGTGCCGAACGGGGGCGGGCGGAAAAGCTGGTA
CGGGCCAGGCTGCGGCGGGAGGTGCTGATCGACGACGGCACCGACGAAGCGCGGGTGAGC
CGCAGGCTGGTGGCGATGTTGGCGCGCCGTGGGTACGGCCAGACCTTGGCGTGCGAGGTG
GTTATCGCCGAGCTGGCCGCCGAGCGGGAGCGCCGACGCGTCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2737c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) V. Pagès, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Interaction	Regulatory Rv2737c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Interaction	Regulatory Rv2737c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv2737c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	Regulatory Rv2737c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) V. Pagès, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Interaction	Regulatory Rv2737c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05
	Expression enhanced in mouse macrophages
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05
	Enhanced expression of recX iowing to a promoter internal to recA