Rv2758c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2758c

Protein Domains

Gene Information
Locus	Rv2758c
Symbol
Gene Name	conserved hypothetical protein
Location	3070583 - 3070849 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:267 bp Protein:89 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9173
Related Genes	MT2828
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2758c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2758c Transcript 1
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMN
RMAENATGTQDEALVNAMWRDGHPENTA*

Genomic Sequence

>Rv2758c
ATGCATCGCGGATATGCATTAGTAGTATGCTCTCCGGGTGTGACGCGCACCATGATCGAC
ATCGATGACGACCTGCTCGCTCGGGCCGCCAAGGAACTGGGTACCACGACAAAGAAAGAC
ACCGTGCATGCCGCGCTGCGGGCCGCGTTGCGAGCCAGTGCCGCGCGCTCGCTCATGAAC
CGGATGGCCGAGAACGCCACCGGAACCCAGGACGAAGCTCTGGTCAACGCAATGTGGCGA
GACGGCCACCCAGAGAACACGGCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv2757c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Inhibits Rv2757c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	Inhibits Rv2757c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv2757c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapB21	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
Other	stop:3070849	active	rslayden	2012-03-05
	MTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
Other	start:3070583	active	rslayden	2012-03-05
	MTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
Symbol	Vap BC-21	active	rslayden	2012-03-05
	MTCY22G8.02 (65 aa), FASTA scores: opt: 97, E(): 2.2, (33.35% identity in 69 aa overlap); etc. Contains PS00402 Binding-protein-dependent transport systems inner membrane comp signature.
Other	strand:+	active	rslayden	2012-03-05
	Rv1113
Other	stop:3070849	active	rslayden	2012-03-05
	Rv1113
Other	start:3070583	active	rslayden	2012-03-05
	Rv1113
Symbol	Vap BC-21	active	rslayden	2012-03-05
	Rv1113
Other	strand:+	active	rslayden	2012-03-05
	MTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565
Other	stop:3070849	active	rslayden	2012-03-05
	MTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565
Other	start:3070583	active	rslayden	2012-03-05
	MTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565
Symbol	Vap BC-21	active	rslayden	2012-03-05
	MTCY48.05c (72 aa), FASTA scores: opt: 106, E(): 0.52, (39.15% identity in 46 aa overlap); O06565
Other	strand:+	active	rslayden	2012-03-05
	MT1611
Other	stop:3070849	active	rslayden	2012-03-05
	MT1611
Other	start:3070583	active	rslayden	2012-03-05
	MT1611
Symbol	Vap BC-21	active	rslayden	2012-03-05
	MT1611
Other	strand:+	active	rslayden	2012-03-05
	Rv1560
Other	stop:3070849	active	rslayden	2012-03-05
	Rv1560
Other	start:3070583	active	rslayden	2012-03-05
	Rv1560
Symbol	Vap BC-21	active	rslayden	2012-03-05
	Rv1560
Other	strand:+	active	rslayden	2012-03-05
	YF60_MYCTU
Other	stop:3070849	active	rslayden	2012-03-05
	YF60_MYCTU
Other	start:3070583	active	rslayden	2012-03-05
	YF60_MYCTU
Symbol	Vap BC-21	active	rslayden	2012-03-05
	YF60_MYCTU
Other	strand:+	active	rslayden	2012-03-05
	Rv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
Other	stop:3070849	active	rslayden	2012-03-05
	Rv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
Other	start:3070583	active	rslayden	2012-03-05
	Rv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
Symbol	Vap BC-21	active	rslayden	2012-03-05
	Rv2545 (92 aa), FASTA scores: opt: 151, E(): 0.00028, (66.65%identity in 45 aa overlap); Q10771
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008
Other	stop:3070849	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008
Other	start:3070583	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008
Symbol	Vap BC-21	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P95008