Rv2829c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2829c

Protein Domains

Gene Information
Locus	Rv2829c
Symbol
Gene Name	conserved hypothetical protein
Location	3136620 - 3137012 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:393 bp Protein:131 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9326
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2829c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2829c Transcript 1
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPV
LSWLQQLAEHVRTVGITPSVAATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRS
HRHPRPVTVW*

Genomic Sequence

>Rv2829c
ATGACGACGGTGCTGCTCGACTCGCATGTGGCCTACTGGTGGTCGGCCGAGCCGCAGCGT
CTCAGCATGGCGGCGAGCCAGGCCATCGAACACGCCGACGAGCTCGCCGTCGCCGCGATT
TCGTGGTTCGAGCTGGCTTGGCTTGCCGAACAGGAACGCATCCAACTGGCGATTCCGGTG
CTGTCCTGGCTTCAGCAGCTGGCCGAGCACGTTCGCACCGTCGGTATCACGCCCTCGGTC
GCCGCCACGGCGGTGGCGCTGCCCTCGTCGTTCCCCGGCGATCCGGCCGACCGGTTGATC
TACGCCACCGCGATCGAACACGGCTGGCGGCTGGTGACCAAGGACCGGCGGCTACGCAGT
CATCGGCACCCACGACCGGTCACCGTCTGGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Symbol	VapC	active	jlew	2012-03-07
	Growth inhibitory in Mt and MS. authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapC22	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	SMA2253 CONSERvED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (125 aa), FASTA scores: opt: 171, E(): 7.7e-05, (34.9% identity in 129 aa overlap); and shows some similarity with other proteins e.g. Q9AH69 HYPOTHETICAL 14.7 KDA PROTEIN from Neisseria meningitidis (128 aa), FASTA scores: opt: 148, E(): 0.0031, (28.1% identity in 121 aa overlap)
Other	stop:3137012	active	rslayden	2012-03-05
	SMA2253 CONSERvED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (125 aa), FASTA scores: opt: 171, E(): 7.7e-05, (34.9% identity in 129 aa overlap); and shows some similarity with other proteins e.g. Q9AH69 HYPOTHETICAL 14.7 KDA PROTEIN from Neisseria meningitidis (128 aa), FASTA scores: opt: 148, E(): 0.0031, (28.1% identity in 121 aa overlap)
Other	start:3136620	active	rslayden	2012-03-05
	SMA2253 CONSERvED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti) (125 aa), FASTA scores: opt: 171, E(): 7.7e-05, (34.9% identity in 129 aa overlap); and shows some similarity with other proteins e.g. Q9AH69 HYPOTHETICAL 14.7 KDA PROTEIN from Neisseria meningitidis (128 aa), FASTA scores: opt: 148, E(): 0.0031, (28.1% identity in 121 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein similar to AAK65872
Other	stop:3137012	active	rslayden	2012-03-05
	Conserved hypothetical protein similar to AAK65872
Other	start:3136620	active	rslayden	2012-03-05
	Conserved hypothetical protein similar to AAK65872